KEGG   Miniopterus natalensis: 107528582
Entry
107528582         CDS       T05883                                 

Gene name
MAP3K2
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 2 isoform X1
  KO
K04420  mitogen-activated protein kinase kinase kinase 2 [EC:2.7.11.25]
Organism
mna  Miniopterus natalensis
Pathway
mna04010  MAPK signaling pathway
mna04540  Gap junction
mna04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107528582 (MAP3K2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107528582 (MAP3K2)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107528582 (MAP3K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mna01001]
    107528582 (MAP3K2)
Enzymes [BR:mna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     107528582 (MAP3K2)
Protein kinases [BR:mna01001]
 Serine/threonine kinases: STE group
  STE11 family
   107528582 (MAP3K2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PB1 Kinase-like FTA2 Kdo
Other DBs
NCBI-GeneID: 107528582
NCBI-ProteinID: XP_016057198
LinkDB
Position
Unknown
AA seq 621 aa
MMDDQQALNSIMQDLAVLHKASRPALSLQETRKTKSLSPKKQNDVRVKFEHRGEKRILQF
PRPVKLEDLRSKAKVAFGQSMELHYTNNELVIPLTTQDDLDKAVELLDRSIHMKSLKILL
VINGSAQATNLEPLPSLDHSDNTVFEAERKKRLSVLGPTSRDQSSPPPGYIPDELHQVAR
NGSFTSINSEGEFIPESMDQMLDPLLLSSPENSGSGSCPSLDSPLDGESYPKSRMPRAQS
YPDNHQEFSVDYDNPIFEKFGKGGTYPRRYHVSYHHQDYNDGRKTFPRARRTQGTSFRSP
VSFSPTDHSLSTSSGSSIFTPEYDDSRMRRRGSDIDNPTLTVMDISPPSRSPRAPINWRL
GKLLGQGAFGRVYLCYDVDTGRELAVKQVQFDPDRPETSKEVNALECEIQLLKNLLHERI
VQYYGCLRDPQEKTLSIFMEYMPGGSIKDQLKAYGALTEHVTRKYTRQILEGVHYLHSNM
IVHRDIKGANILRDSTGNVKLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVISGEGY
GRKADIWSVGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPKLPPHVSDYTRDFLKRIF
IEAKLRPSAGELLRHVFVHCH
NT seq 1866 nt   +upstreamnt  +downstreamnt
atgatggatgatcagcaagctttgaactcaatcatgcaagatttggctgttcttcataag
gccagtcgaccagcattatccttacaggaaaccagaaaaacaaaatctttatcaccaaaa
aagcagaatgatgtccgagtcaaatttgaacatagaggagaaaaaagaatccttcagttc
cccagaccagttaaactggaagatctgaggtctaaagctaaagttgcctttggacagtct
atggagctacattataccaataatgagttggtaattccactaactactcaagatgacttg
gacaaggccgtggaactgctggaccgcagtattcatatgaagagcctcaaaatactactt
gtaataaacggaagtgcacaggctactaatttagaaccattgccatcactagatcattcg
gataacacagtattcgaagcagagaggaaaaaacggctttctgtactaggtcccactagt
agagatcaaagctcccctcccccaggatacattccagatgaattacatcaggttgcccgg
aatgggtcattcaccagtatcaacagtgaaggagagtttattccagagagcatggaccaa
atgctggacccattacttttaagcagtcctgaaaattctggctcaggaagttgtccctca
cttgatagtcctttggatggagagagctatccaaaatcacgaatgcctagggcacagagc
tacccagataatcaccaggaattttcagtagactatgataaccctatctttgagaaattt
gggaaaggaggaacgtatccaaggaggtatcatgtttcatatcaccatcaagactataat
gatggtcggaaaacttttccaagagctagaagaacccaggggaccagcttccggtctcct
gtcagtttcagtcctactgaccactccttaagcactagtagtggaagcagtatctttacc
ccagagtacgatgatagtcggatgagaagaaggggaagtgacatagataatcccactttg
actgtaatggacatcagcccacccagccgctcacctcgtgctccaatcaactggagattg
ggcaaactgcttggccagggggcctttggcagggtctacctctgttacgatgtcgataca
ggaagagagttggctgttaagcaagttcagtttgacccggatagacctgagaccagcaag
gaagtaaatgcacttgagtgtgaaattcagttgttgaaaaatttgctgcatgaacgaatt
gttcagtattatggctgtttgagggatccccaggaaaaaacactttccatatttatggaa
tatatgccagggggttcaattaaggaccaattaaaagcatatggagctcttactgagcat
gtgactaggaaatacacccgtcagattctggagggtgtccattatttgcacagtaatatg
attgttcatagagatatcaaaggtgcaaatattctgcgagattcaactggcaacgtcaaa
ctaggagattttggggccagcaaacggcttcaaaccatctgtctttcggggacaggaatg
aagtctgtcacaggcacgccctactggatgagcccggaagtgatcagtggagaaggctat
ggcaggaaagcagacatctggagcgtgggctgcactgtggtagaaatgctgaccgaaaaa
ccgccttgggcagagtatgaagcaatggctgccatctttaaaatcgccactcagccaaca
aacccaaagctgccaccgcacgtctcggactacactcgcgatttcctcaaacggatcttt
atagaggccaaactgagaccttcagcgggtgaactcctaaggcacgtgtttgtgcactgt
cattag

DBGET integrated database retrieval system