KEGG   Miniopterus natalensis: 107529440
Entry
107529440         CDS       T05883                                 

Gene name
IMPDH2
Definition
(RefSeq) inosine-5'-monophosphate dehydrogenase 2 isoform X1
  KO
K00088  IMP dehydrogenase [EC:1.1.1.205]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna00983  Drug metabolism - other enzymes
mna01100  Metabolic pathways
Module
mna_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107529440 (IMPDH2)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    107529440 (IMPDH2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107529440 (IMPDH2)
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.205  IMP dehydrogenase
     107529440 (IMPDH2)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107529440 (IMPDH2)
  Exosomal proteins of breast cancer cells
   107529440 (IMPDH2)
SSDB
Motif
Pfam: IMPDH CBS NMO FMN_dh His_biosynth ThiG Dus Glu_synthase G3P_antiterm
Other DBs
NCBI-GeneID: 107529440
NCBI-ProteinID: XP_016058327
LinkDB
Position
Unknown
AA seq 538 aa
MADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFTADQVDLTSALTKKIT
LKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKYEQGFITDPVV
LSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDRFLEEIMT
KRDDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKDA
KKQLLCGAAIGTHEDDKYRLDLLAQAGVDAVVLDSSQGNSIFQINMIKYIKDKYPSLQVI
GGNVVTAAQAKNLIDAGVDALRVGMGSGSICITQEAAPKIPPDIKSHSPKCPSTVTGCYM
LACGRPQATAVYKVSEYARRFGVPVIADGGIQNVGHIAKALALGASTVMMGSLLAATTEA
PGEYFFSDGIRLKKYRGMGSLDAMDKHLSSQNRYFSEADKIKVAQGVSGAVQDKGSIHKF
VPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF
NT seq 1617 nt   +upstreamnt  +downstreamnt
atggccgactacctgattagcgggggcacgtcctacgtgccggacgacgggcttacggca
cagcagctgttcaactgcggggatggcctcacctacaatgactttctcattctccccggg
tacatcgacttcactgcagaccaggtggacttgacctctgctctgaccaaaaagatcact
ctgaaaaccccactggtttcctcacccatggacacagtcacagaggctgggatggccata
gcaatggcgcttacaggtggtattggcttcatccaccacaactgtacacctgaattccag
gccaacgaagttcggaaagtgaagaaatatgagcagggcttcattacggaccctgtggtc
ctcagccctaaggatcgagtacgggacgtgtttgaagccaaggcccggcatggcttctgc
ggtatccccatcaccgacaccggccggatggggagccgcctggtgggcatcatctcctcg
agggacattgattttctcaaggaggaggaacatgaccggtttttggaagagatcatgacc
aagagagatgatttggtggtagcccctgcaggcatcacattgaaggaagcaaatgaaatt
ctgcagcgcagcaagaagggaaagttgcccattgtaaatgaagatgatgaactggtggcc
atcatcgcccggacagacctgaagaagaaccgggattacccactagcctccaaagatgcc
aagaagcagctgctgtgtggagcagccatcggcactcatgaagatgacaagtatcggctg
gacttgctagcccaggccggtgtggatgcagttgttttggactcttctcagggaaactcc
atcttccagattaacatgatcaagtacatcaaagataaataccccagtctccaagtcatc
ggaggcaatgtggtaacagctgctcaggccaagaatctcattgatgctggtgtagatgcc
ctgcgggtgggcatgggcagtggctccatctgcatcacccaggaagcagctcccaagatc
cctccagacataaagtcccacagccccaaatgcccttctactgtcacgggctgctatatg
ctggcctgtgggcggccccaagcaacagcagtgtacaaggtatcagaatatgcacggcgc
tttggtgttcctgtcatcgctgatggaggaatccaaaatgtgggccatatcgccaaagcc
ttggcccttggggcctccacagtcatgatgggctccctcctggctgctaccactgaggcc
cctggtgagtacttcttctccgatggaatccggctaaagaaataccgtggtatgggctct
ctcgacgccatggacaagcatctcagcagccagaaccgatatttcagtgaagctgacaaa
atcaaggtggcccagggggtatctggggctgtgcaggataaagggtccatccacaaattt
gtcccctacctgatcgccggcatccaacactcctgccaggacattggtgccaagagtttg
acccaagtcagagccatgatgtattctggggagctcaagtttgagaagagaacgtcctca
gctcaggtggaaggtggcgtccacagcctgcattcgtatgagaagcggcttttctga

KEGG   Miniopterus natalensis: 107537389
Entry
107537389         CDS       T05883                                 

Gene name
IMPDH1
Definition
(RefSeq) inosine-5'-monophosphate dehydrogenase 1 isoform X1
  KO
K00088  IMP dehydrogenase [EC:1.1.1.205]
Organism
mna  Miniopterus natalensis
Pathway
mna00230  Purine metabolism
mna00983  Drug metabolism - other enzymes
mna01100  Metabolic pathways
Module
mna_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107537389 (IMPDH1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    107537389 (IMPDH1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mna04147]
    107537389 (IMPDH1)
Enzymes [BR:mna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.205  IMP dehydrogenase
     107537389 (IMPDH1)
Exosome [BR:mna04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107537389 (IMPDH1)
  Exosomal proteins of breast cancer cells
   107537389 (IMPDH1)
SSDB
Motif
Pfam: IMPDH CBS NMO FMN_dh His_biosynth NanE ThiG Glu_synthase DHO_dh G3P_antiterm
Other DBs
NCBI-GeneID: 107537389
NCBI-ProteinID: XP_016068883
LinkDB
Position
Unknown
AA seq 550 aa
MADYLISGGTGYVPEDGLTAQQLFANADGLTYNDFLILPGFIDFIADEVDLTSALTRKIT
LKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKKFEQGFITDPVV
LSPSHTVGDVLEAKIRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMT
LRNELVVAPAGVTLKEANEILQLSKKGKLPIVNDRDELVAIIARTDLKKNRDYPLASKDS
HKQLLCGAAVGTREDDKYRLDLLTQAGTDVIVLDSSQGNSEYQIAMVHYIKKKYPHLQVI
GGNVVTAAQAKNLIDAGVDGLRVGMGCGSICITQEVMACGRPQGTAVYKVAEYARRFGVP
VIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAM
EKSSSSQKRYFSEGDKVKVPQGVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGARSLSVLR
SMMYSGELKFEKRTMSAQIEGGVHGLHSYTFLPFTRSGCTEDGGGSRGGGRGGRGGMPQG
PPLGTASLHN
NT seq 1653 nt   +upstreamnt  +downstreamnt
atggcggattacctgatcagcggcggcaccggctacgtgcccgaggatgggctcacggcg
cagcagctcttcgccaacgccgacgggctcacctacaatgacttcctgattctcccagga
ttcatagacttcatagctgatgaggtggacctgacttcagctctgactcggaagatcaca
ttgaagacaccgctgatctcctccccaatggacactgtgacagaggctgacatggctatc
gctatggctctgatgggtggaattggtttcattcaccacaactgcactccagagttccag
gccaatgaagtgcggaaggtgaagaaatttgaacagggctttatcacagaccccgtggtg
ctgagcccctcgcacaccgtgggcgacgtactggaggccaagattcggcatggcttctct
ggcatccccatcactgaaacaggcaccatgggtagcaagctggtgggcatcgtcacctcc
cgagacattgactttcttgcagagaaggaccacaccaccctcctcagtgaggtgatgaca
ctgcggaatgagctggtggtggctccagcaggtgtgacattgaaagaggcaaatgagatc
ctgcagctcagcaagaaaggaaagctgcccattgtcaatgatcgcgatgagctagtggcg
atcattgcccgcaccgacctgaagaagaaccgggactaccccctagcctccaaggattcc
cacaagcaactgctgtgcggggcggctgtgggcacccgcgaggacgacaaataccgcctg
gacctgctcacccaggcgggcaccgatgtcatagtgctggactcatctcaagggaactct
gagtatcagattgccatggtgcactatatcaagaagaagtatccccacctccaggtgatt
ggggggaatgtggtgacagcagctcaggccaagaatctgattgatgctggcgtggacggg
ctgcgtgtgggcatgggctgtggctccatctgcatcacccaagaagtgatggcctgtggc
cggcctcagggcactgccgtgtataaggtggctgagtatgctcggcgctttggggtgcca
gtcatagctgatggtggcatccagactgtggggcatgtggtcaaggccctagcccttgga
gcatccacagtgatgatgggctccctgctggctgccaccacagaggcccctggcgagtac
ttcttctccgatggggtgaggctcaagaagtaccggggcatgggttccttggatgccatg
gagaagagcagcagcagccagaaacgatacttcagtgagggggataaggtgaaggtccca
cagggcgtatcaggttccatccaggacaaaggctccattcagaagtttgtgccctacctc
atagcggggatccagcatggctgccaggatattggtgcccggagcctgtctgtcctgcgg
tccatgatgtactcaggagagctcaagtttgagaagcggaccatgtctgcccagattgag
ggtggcgtccacggcctgcactcctatacctttctgccgtttacgagaagcggctgtact
gaggatggcggtggaagccgtggtggaggccgcggtggcagagggggtatgccccagggt
ccccctttaggcacagcctccctccataactga

DBGET integrated database retrieval system