KEGG   Miniopterus natalensis: 107530099
Entry
107530099         CDS       T05883                                 

Gene name
EGR1
Definition
(RefSeq) early growth response protein 1
  KO
K09203  early growth response protein 1
Organism
mna  Miniopterus natalensis
Pathway
mna04371  Apelin signaling pathway
mna04912  GnRH signaling pathway
mna04928  Parathyroid hormone synthesis, secretion and action
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna05020  Prion disease
mna05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107530099 (EGR1)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107530099 (EGR1)
   04928 Parathyroid hormone synthesis, secretion and action
    107530099 (EGR1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    107530099 (EGR1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107530099 (EGR1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107530099 (EGR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mna03000]
    107530099 (EGR1)
Transcription factors [BR:mna03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    107530099 (EGR1)
SSDB
Motif
Pfam: DUF3432 DUF3446 zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2HC_2 Zf_RING zf-BED zf-H2C2_5
Other DBs
NCBI-GeneID: 107530099
NCBI-ProteinID: XP_016059218
LinkDB
Position
Unknown
AA seq 470 aa
MEGDKKNEWEVSPEEAGEARLGLESFPDISLSNEKVLVETSYPSQTTRLPPITYTGRFSL
EPAPNSGNTLWPEPLFSLVSGLVSMTNAPATSSSAPSPAASSSSSSSSSSSQSPPLSCAV
QSSDSSPIYSAAPTFPTPNADIFPEPQSQAFPGPAGTALQYPPPAYPAAKGSFQVPMIPD
YLFPQQQGDLGLGTPDQKPFQGLEGRTQQPSLTPLSTIKAFATQSGSQDLKALNTTYQSQ
LIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICM
RNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQKDKKADKGGVGVA
SSAGAPSLSSYSSPVATSYTSPVTTSYPSPATTSYPSPVPTSYSSPGSSTYPSPVHSGFP
SPSVATTYSSVPPAFQVGSFHSSAVTNSFSSSTGLSDMTTTFSPRTIEIC
NT seq 1413 nt   +upstreamnt  +downstreamnt
atggagggtgacaaaaagaatgagtgggaagtctctccggaggaggctggtgaagcacgt
ctgggtctagagtcctttcctgacatctcgctgagtaacgagaaggttctggtggagacg
agctaccccagccagaccacgcggctgccccccatcacctacactggccgcttctctctg
gagcccgcacccaacagtggcaacaccttgtggcctgagcccctcttcagcctggtcagc
gggctcgtgagcatgaccaacgcacccgccacctcctcctcggcaccgtctccggcggcc
tcctcctcctcctcctcctcctcctcctcctcccagagcccacccctgagctgcgcggtg
cagtccagcgacagcagccccatttactcagcggcgcccaccttccccacacccaacgcc
gacatcttccccgagccgcagagccaggccttcccgggccccgcgggcaccgcgctccag
tacccgcctcccgcctacccggccgccaagggcagcttccaggtccccatgatcccagac
tatctgtttccacaacagcagggggacctgggcctgggcaccccagaccagaagcccttc
cagggcctggagggccgcacccagcagccgtcgctcacgcccctctccaccatcaaggcc
tttgccacgcagtcgggctcccaggacctaaaggccctcaacaccacctaccagtcccag
ctcatcaaacctagccgcatgcgcaagtaccccaaccggcccagcaagacgcccccccac
gaacgcccctacgcctgcccggtggagtcctgcgaccgccgcttctcgcgctcagatgag
ctcacccgccacattcgcatccacaccggccagaagcccttccagtgtcgcatctgcatg
cgcaacttcagccgcagcgaccacctcaccacccacatccgcacccacacgggcgagaag
cccttcgcctgcgacatctgcgggagaaagtttgccaggagcgatgaacgcaagaggcat
accaagatccacctgcggcagaaagacaaaaaggcagacaaaggtggtgttggtgtggcc
tcctcagcgggggccccgtccctctcttcctactcgtcacccgtggctacctcctacacc
tccccggtcactacctcttacccatccccagccaccacctcgtacccatcacctgtgccc
acctcctattcctctccgggctcctcgacctacccatcccctgtgcacagtggcttcccc
tcgccctccgtggccaccacatactcctccgttccccctgctttccaagttggcagcttc
cattcctcagctgtcaccaactccttcagctcctccacggggctttcggacatgacaacc
accttttctcccaggacaattgaaatttgctag

DBGET integrated database retrieval system