KEGG   Miniopterus natalensis: 107531298
Entry
107531298         CDS       T05883                                 

Gene name
DRD2
Definition
(RefSeq) D(2) dopamine receptor isoform X1
  KO
K04145  dopamine receptor D2
Organism
mna  Miniopterus natalensis
Pathway
mna04015  Rap1 signaling pathway
mna04024  cAMP signaling pathway
mna04080  Neuroactive ligand-receptor interaction
mna04540  Gap junction
mna04728  Dopaminergic synapse
mna05012  Parkinson disease
mna05030  Cocaine addiction
mna05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107531298 (DRD2)
   04024 cAMP signaling pathway
    107531298 (DRD2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107531298 (DRD2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107531298 (DRD2)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    107531298 (DRD2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107531298 (DRD2)
  09165 Substance dependence
   05030 Cocaine addiction
    107531298 (DRD2)
   05034 Alcoholism
    107531298 (DRD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mna04030]
    107531298 (DRD2)
G protein-coupled receptors [BR:mna04030]
 Rhodopsin family
  Biogenic amine
   Dopamine
    107531298 (DRD2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7TM_GPCR_Srt 7tm_4 RIFIN CPV_Polyhedrin Stevor
Other DBs
NCBI-GeneID: 107531298
NCBI-ProteinID: XP_016060821
LinkDB
Position
Unknown
AA seq 443 aa
MDPLNLSWYDEDLESQNWSRPFNGSTGKADRPHYNYYAMLLTLLIFAIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLLAMLVMPWGVYLEVVGEWRFSKIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPMLFGLNNTEQS
ECIIADPAFVIYSSVVSFYAPFIITLLVYIKIYIVLRRRRKRVNTKRSSRAFRANLKAPL
KGSCTHPEDMRLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHSLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQSMPNGKTRTSLKTLSR
RKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCACSIPPVLYSSFTWLGYVNSA
VNPIIYTTFNIEFRKAFLKLLHC
NT seq 1332 nt   +upstreamnt  +downstreamnt
atggacccgctgaacctgtcctggtacgatgaggacctggagagccagaactggagccgg
cccttcaacgggtccacggggaaggccgaccggccccactacaactactacgccatgctg
ctcaccctgctcatcttcgccatcgtcttcggcaacgtgctggtgtgcatggccgtgtcc
cgcgagaaggcgctgcagaccaccaccaactacctgatcgtcagcctggccgtggccgac
ctcctgctagccatgctggtcatgccctggggcgtctacctggaggtggtgggtgagtgg
agattcagcaagattcactgtgacatctttgtcactctggacgtcatgatgtgcacagca
agcatcctgaacctgtgtgccatcagcattgacaggtacacggctgtggccatgcccatg
ctctataacacacgctacagctccaagcgccgagtcaccgtcatgatcgccatagtctgg
gtcctgtccttcaccatctcctgcccaatgctctttggactcaacaacacagaacagagc
gaatgcatcatcgccgatcccgccttcgtgatctactcctctgtggtctccttctacgcg
cccttcatcatcaccctgctggtctacatcaagatctacattgtcctccggaggcggcga
aagcgggtcaacaccaagcgcagcagccgggctttcagggccaacctgaaggccccactc
aagggcagctgtactcaccccgaggacatgagactctgcaccgttatcatgaagtctaat
ggcagtttccctgtgaacaggcggagagtggaggctgcccgccgagcccaggagctggag
atggagatgctctccagcaccagcccacctgagaggacccggtacagccccatcccaccc
agccaccaccagctgaccctccccgacccatcccaccacagcctccacagcactcctgac
agccctgccaaacctgagaagaatgggcatgccaaagaccaccccaagattgccaagatc
tttgagatccagtccatgcccaatggcaaaacccggacctcgcttaagaccctgagccgc
aggaagctctcgcagcagaaggagaagaaagccacccagatgctggccatagtgcttggc
gtgttcatcatctgctggctgcccttcttcatcactcacatcctgaacatccactgtgcc
tgcagcatcccgcctgtcctgtacagctccttcacgtggctgggctacgtcaacagcgct
gtgaaccccatcatctacacgaccttcaacattgagttccgcaaggccttcctgaagctc
ctccactgctga

DBGET integrated database retrieval system