KEGG   Miniopterus natalensis: 107537434
Entry
107537434         CDS       T05883                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
mna  Miniopterus natalensis
Pathway
mna01522  Endocrine resistance
mna04068  FoxO signaling pathway
mna04110  Cell cycle
mna04115  p53 signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04218  Cellular senescence
mna04310  Wnt signaling pathway
mna04340  Hedgehog signaling pathway
mna04371  Apelin signaling pathway
mna04390  Hippo signaling pathway
mna04510  Focal adhesion
mna04530  Tight junction
mna04630  JAK-STAT signaling pathway
mna04917  Prolactin signaling pathway
mna04919  Thyroid hormone signaling pathway
mna04921  Oxytocin signaling pathway
mna04933  AGE-RAGE signaling pathway in diabetic complications
mna04934  Cushing syndrome
mna05160  Hepatitis C
mna05162  Measles
mna05163  Human cytomegalovirus infection
mna05165  Human papillomavirus infection
mna05166  Human T-cell leukemia virus 1 infection
mna05167  Kaposi sarcoma-associated herpesvirus infection
mna05169  Epstein-Barr virus infection
mna05200  Pathways in cancer
mna05203  Viral carcinogenesis
mna05205  Proteoglycans in cancer
mna05206  MicroRNAs in cancer
mna05210  Colorectal cancer
mna05212  Pancreatic cancer
mna05213  Endometrial cancer
mna05214  Glioma
mna05215  Prostate cancer
mna05216  Thyroid cancer
mna05218  Melanoma
mna05219  Bladder cancer
mna05220  Chronic myeloid leukemia
mna05221  Acute myeloid leukemia
mna05222  Small cell lung cancer
mna05223  Non-small cell lung cancer
mna05224  Breast cancer
mna05225  Hepatocellular carcinoma
mna05226  Gastric cancer
mna05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107537434 (CCND1)
   04340 Hedgehog signaling pathway
    107537434 (CCND1)
   04390 Hippo signaling pathway
    107537434 (CCND1)
   04371 Apelin signaling pathway
    107537434 (CCND1)
   04630 JAK-STAT signaling pathway
    107537434 (CCND1)
   04068 FoxO signaling pathway
    107537434 (CCND1)
   04151 PI3K-Akt signaling pathway
    107537434 (CCND1)
   04152 AMPK signaling pathway
    107537434 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107537434 (CCND1)
   04115 p53 signaling pathway
    107537434 (CCND1)
   04218 Cellular senescence
    107537434 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107537434 (CCND1)
   04530 Tight junction
    107537434 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    107537434 (CCND1)
   04921 Oxytocin signaling pathway
    107537434 (CCND1)
   04919 Thyroid hormone signaling pathway
    107537434 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107537434 (CCND1)
   05206 MicroRNAs in cancer
    107537434 (CCND1)
   05205 Proteoglycans in cancer
    107537434 (CCND1)
   05203 Viral carcinogenesis
    107537434 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107537434 (CCND1)
   05212 Pancreatic cancer
    107537434 (CCND1)
   05225 Hepatocellular carcinoma
    107537434 (CCND1)
   05226 Gastric cancer
    107537434 (CCND1)
   05214 Glioma
    107537434 (CCND1)
   05216 Thyroid cancer
    107537434 (CCND1)
   05221 Acute myeloid leukemia
    107537434 (CCND1)
   05220 Chronic myeloid leukemia
    107537434 (CCND1)
   05218 Melanoma
    107537434 (CCND1)
   05219 Bladder cancer
    107537434 (CCND1)
   05215 Prostate cancer
    107537434 (CCND1)
   05213 Endometrial cancer
    107537434 (CCND1)
   05224 Breast cancer
    107537434 (CCND1)
   05222 Small cell lung cancer
    107537434 (CCND1)
   05223 Non-small cell lung cancer
    107537434 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107537434 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107537434 (CCND1)
   04934 Cushing syndrome
    107537434 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107537434 (CCND1)
   05162 Measles
    107537434 (CCND1)
   05160 Hepatitis C
    107537434 (CCND1)
   05163 Human cytomegalovirus infection
    107537434 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107537434 (CCND1)
   05169 Epstein-Barr virus infection
    107537434 (CCND1)
   05165 Human papillomavirus infection
    107537434 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107537434 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 107537434
NCBI-ProteinID: XP_016068946
LinkDB
Position
Unknown
AA seq 214 aa
MNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLTAEKLCIYTDNSIQPEELLHTE
LLLVNKLKWNLAAMTPHDFIEHFLSKMPVAEVHKQVIRKHAQTFVALCATDVKFISNPPS
MVAAGSVVAAVQGLHLGSSNSVLSYHRLTRFLSKVIKCDPDCLRACQEQIEALLESSLRQ
AQQSLDLKVVEEEEVLEEEADLACTPTDVRDVNI
NT seq 645 nt   +upstreamnt  +downstreamnt
atgaactacctggaccgcttcctgtcgctggagcccgtgaaaaagagccgcctgcagctg
ctgggggccacctgcatgttcgtggcctcgaagatgaaggagaccatccccctgacggcg
gagaagttgtgcatctacaccgacaactccatccagcccgaagagctgctgcacaccgag
ctgctgctggtgaacaagctcaagtggaacctggcggccatgacccctcacgacttcatc
gaacacttcctctccaaaatgcccgtggccgaggtgcacaagcaggtcatccgcaaacac
gcgcagaccttcgtcgccctctgtgccacagacgtgaagttcatttccaaccctccctcc
atggtggccgcagggagtgtggtggccgcggtgcaaggccttcatctggggagctccaac
agcgtcctgtcctaccaccgcctcacccggttcctctccaaagtgatcaagtgcgacccc
gactgcctccgggcctgccaggagcagatcgaggccctgctggagtccagcctgcgccag
gcccagcagagcctggacctcaaggtggtggaagaggaggaggtgctggaggaggaggca
gacctggcctgcacgcccactgacgtgcgcgacgtgaacatctga

DBGET integrated database retrieval system