KEGG   Miniopterus natalensis: 107543998
Entry
107543998         CDS       T05883                                 

Definition
(RefSeq) natural killer cells antigen CD94-like
  KO
K06516  killer cell lectin-like receptor subfamily D member 1
Organism
mna  Miniopterus natalensis
Pathway
mna04612  Antigen processing and presentation
mna04650  Natural killer cell mediated cytotoxicity
mna05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107543998
   04612 Antigen processing and presentation
    107543998
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    107543998
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mna04090]
    107543998
   04091 Lectins [BR:mna04091]
    107543998
CD molecules [BR:mna04090]
 Proteins
  107543998
Lectins [BR:mna04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   107543998
SSDB
Motif
Pfam: Lectin_C UL45 Chordopox_A33R
Other DBs
NCBI-GeneID: 107543998
NCBI-ProteinID: XP_016077222
LinkDB
Position
Unknown
AA seq 210 aa
MCLLPAVQNRKPTWSLHQLAELKAILIAAVNIPLAFQATPWRLISGIFGVTCLVLMATLG
ILLKNRFTKQSIQSTSSPGPTIEPQEGPGCCSCQEKWIGYKCNCYFLSDERKTWAESRDF
CASQNSSLLQLQNRDELDFINTSRFYWIGLTYSENRHAWLWEDGSAFSRDLFVFPQRTNT
KNCIAYNPSKNVVDEPCEEKHRYICKQRLI
NT seq 633 nt   +upstreamnt  +downstreamnt
atgtgcctgttaccagctgtgcagaaccgaaaacccacatggtcactacatcagttggca
gaactcaaagctattctcatagctgcagtcaatattcctctggcttttcaggccactcca
tggaggttgatttctgggatcttcggagtaacctgccttgtgttgatggctactttggga
attttgttgaaaaatagatttactaaacaaagtattcagtcaacatcatctccaggaccc
accattgaaccccaggaaggtcctggctgctgttcttgccaagaaaagtggatcggttac
aaatgcaactgttacttcctttccgatgaaagaaaaacttgggcagaaagtagggatttc
tgtgcttctcagaattccagtctacttcagttacaaaacagagatgaactggattttata
aataccagtagattttactggattggactcacttacagtgaaaaccgccatgcctggctg
tgggaagatggctctgctttctcccgagatctatttgtattccctcaaaggacaaataca
aagaactgcatagcatataacccaagcaagaatgttgtagatgagccctgtgaagaaaaa
catcgttatatctgtaaacagcggcttatctag

KEGG   Miniopterus natalensis: 107543999
Entry
107543999         CDS       T05883                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: NKG2-A/NKG2-B type II integral membrane protein-like
  KO
K06541  killer cell lectin-like receptor subfamily C1
Organism
mna  Miniopterus natalensis
Pathway
mna04612  Antigen processing and presentation
mna04650  Natural killer cell mediated cytotoxicity
mna05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107543999
   04612 Antigen processing and presentation
    107543999
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    107543999
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mna04090]
    107543999
   04091 Lectins [BR:mna04091]
    107543999
CD molecules [BR:mna04090]
 Proteins
  107543999
Lectins [BR:mna04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   107543999
SSDB
Motif
Pfam: Lectin_C Chordopox_A33R UL45
Other DBs
NCBI-GeneID: 107543999
NCBI-ProteinID: XP_016077223
LinkDB
Position
Unknown
AA seq 233 aa
MDTQGENGSEPNLAKDSRRQQVKGKGVRSSVXVTEQRIPSVGIGSDASQDLQWDDKNDPC
KDSPSPPEKVIAGILGVICLILMYSIVRVIHFMPGTVILEKTNSSPKTRIQKAHNCRRCP
LEWFTYSNNCYNIGTEDKTWRESLMACASKNSSLLHIDDEEERKFLSPMSPPSWVGAFRN
SSDHPGMWINGSTFKLKIAELSTGKGDCALLNPYGSTSWNWGSSKIYSCKHKL
NT seq 702 nt   +upstreamnt  +downstreamnt
atggatacccagggagaaaacggctcggaaccgaacctggccaaggactcgagaagacag
caagtgaaaggtaagggcgtgagaagctccgttntagtcactgaacagcgaataccctct
gtggggataggctcagacgcctctcaggatcttcaatgggatgacaagaatgacccctgc
aaagattcaccatcgcctccagagaaggtcattgctgggatcctgggagtcatttgcctc
atcttgatgtacagcatagtaagagtgatacattttatgcctggtactgtaatactggag
aagaccaattcatcccccaaaacaaggatccagaaagcacataattgtcgtcgttgtcca
ctggagtggtttacatattccaacaattgctataacattggtactgaagataaaacatgg
cgtgagagtctgatggcctgtgcttccaagaactctagcttgcttcatatagatgatgaa
gaagaaaggaaatttctgagtcccatgtcacctccatcatgggttggagcttttcgtaac
agcagtgatcatcctgggatgtggataaatggttcaactttcaaactgaagatagcagaa
ttatcaactggtaaaggtgactgtgctctgctaaacccatatggctccacatcatggaat
tggggatcttcaaaaatatatagctgcaagcataagctttag

KEGG   Miniopterus natalensis: 107544001
Entry
107544001         CDS       T05883                                 

Definition
(RefSeq) NKG2-A/NKG2-B type II integral membrane protein-like
  KO
K06541  killer cell lectin-like receptor subfamily C1
Organism
mna  Miniopterus natalensis
Pathway
mna04612  Antigen processing and presentation
mna04650  Natural killer cell mediated cytotoxicity
mna05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mna00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107544001
   04612 Antigen processing and presentation
    107544001
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    107544001
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mna04090]
    107544001
   04091 Lectins [BR:mna04091]
    107544001
CD molecules [BR:mna04090]
 Proteins
  107544001
Lectins [BR:mna04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   107544001
SSDB
Motif
Pfam: Lectin_C Chordopox_A33R UL45 SIT
Other DBs
NCBI-GeneID: 107544001
NCBI-ProteinID: XP_016077224
LinkDB
Position
Unknown
AA seq 233 aa
MSKERVTYTELNLAKYAKTQRMKPKRTKSSVPVTEQEITYAELNLHSAPQDLQRNDLHEH
CRDSPSPPEKVIAGILGVICLVLMSAVVTIAVTPSSVILEKTNSTQKARIQRAHNCGRCP
LEWLTYSNNCYNVSTEHKTWRESLMACASKNSSLLHIDDEEERKFLSSMSPPSWVGALRK
SRDHPWIWINGSTFKLNEAHLSTGKVNCSVMHPYGLSSESCGSSKLYICKHKL
NT seq 702 nt   +upstreamnt  +downstreamnt
atgagtaaggaaagagtaacctacacagaactgaacttggccaagtatgcaaagacacaa
cgaatgaaacctaagcgcaccaaaagctccgtgccagtgactgagcaggaaataacctat
gcagaattaaaccttcacagtgctcctcaggatctgcagaggaatgacctgcatgagcac
tgcagagattccccatcacctccggaaaaggtcattgctgggatcctcggagtcatctgc
cttgtcttgatgtccgctgtggtaacaatagctgttactccctcttctgtaatactggag
aagaccaattcgacccaaaaagcaaggatccaaagagcacataattgtggtcgttgtccc
ctggagtggcttacatattccaacaattgctataacgttagtactgaacataaaacatgg
cgtgagagtctgatggcctgtgcttccaagaactctagcttgcttcatatagatgatgaa
gaagaaaggaaatttctgagttccatgtcacctccatcatgggttggagctttacgtaaa
agcagggatcatccttggatatggataaatggttcaactttcaaactgaatgaagcacat
ttatcaactggtaaagttaactgtagtgtgatgcacccatatggcctctcatcggagagc
tgtggatcttcaaaactatacatctgcaagcataagctttag

DBGET integrated database retrieval system