KEGG   Miniopterus natalensis: 107544497
Entry
107544497         CDS       T05883                                 

Gene name
VAMP2
Definition
(RefSeq) vesicle-associated membrane protein 2
  KO
K13504  vesicle-associated membrane protein 2
Organism
mna  Miniopterus natalensis
Pathway
mna04130  SNARE interactions in vesicular transport
mna04721  Synaptic vesicle cycle
mna04911  Insulin secretion
mna04962  Vasopressin-regulated water reabsorption
mna04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:mna00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    107544497 (VAMP2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107544497 (VAMP2)
  09154 Digestive system
   04970 Salivary secretion
    107544497 (VAMP2)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107544497 (VAMP2)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    107544497 (VAMP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mna04131]
    107544497 (VAMP2)
Membrane trafficking [BR:mna04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   VAMP
    107544497 (VAMP2)
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    107544497 (VAMP2)
SSDB
Motif
Pfam: Synaptobrevin MCU PRIMA1 Tweety
Other DBs
NCBI-GeneID: 107544497
NCBI-ProteinID: XP_016077886
LinkDB
Position
Unknown
AA seq 134 aa
LRGRTIQAVGLNPSPPLRSATAATAPPAAPAGEGGPPGPPPNLTSNRRLQQTQAQVDEVV
DIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVIC
AIILIIIIGTGCDL
NT seq 405 nt   +upstreamnt  +downstreamnt
ctgcggggccgtactatccaggcagtgggtcttaatccgtctccgcccctcaggtcggct
accgcagccaccgccccccctgccgccccggctggggagggaggtccccctgggccccct
ccaaatctcaccagtaacagaagactgcagcagactcaggcccaggtggatgaggtggtg
gacattatgagggtgaacgtggacaaggtcctggagcgggaccagaagctgtcggagctg
gacgaccgtgcagatgcactccaggcaggggcttctcagtttgaaacaagtgcagccaag
ctcaagcgcaaatattggtggaaaaacctcaagatgatgatcatcttgggagtgatttgc
gccatcatcctcatcatcatcatcggtactggctgtgatctgtga

DBGET integrated database retrieval system