KEGG   Miniopterus natalensis: 107545147
Entry
107545147         CDS       T05883                                 

Gene name
IGF1
Definition
(RefSeq) insulin-like growth factor I isoform X1
  KO
K05459  insulin-like growth factor 1
Organism
mna  Miniopterus natalensis
Pathway
mna01521  EGFR tyrosine kinase inhibitor resistance
mna01522  Endocrine resistance
mna04010  MAPK signaling pathway
mna04014  Ras signaling pathway
mna04015  Rap1 signaling pathway
mna04066  HIF-1 signaling pathway
mna04068  FoxO signaling pathway
mna04114  Oocyte meiosis
mna04115  p53 signaling pathway
mna04150  mTOR signaling pathway
mna04151  PI3K-Akt signaling pathway
mna04152  AMPK signaling pathway
mna04211  Longevity regulating pathway
mna04213  Longevity regulating pathway - multiple species
mna04510  Focal adhesion
mna04550  Signaling pathways regulating pluripotency of stem cells
mna04730  Long-term depression
mna04750  Inflammatory mediator regulation of TRP channels
mna04913  Ovarian steroidogenesis
mna04914  Progesterone-mediated oocyte maturation
mna04935  Growth hormone synthesis, secretion and action
mna04960  Aldosterone-regulated sodium reabsorption
mna05200  Pathways in cancer
mna05202  Transcriptional misregulation in cancer
mna05205  Proteoglycans in cancer
mna05214  Glioma
mna05215  Prostate cancer
mna05218  Melanoma
mna05224  Breast cancer
mna05410  Hypertrophic cardiomyopathy
mna05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107545147 (IGF1)
   04014 Ras signaling pathway
    107545147 (IGF1)
   04015 Rap1 signaling pathway
    107545147 (IGF1)
   04066 HIF-1 signaling pathway
    107545147 (IGF1)
   04068 FoxO signaling pathway
    107545147 (IGF1)
   04151 PI3K-Akt signaling pathway
    107545147 (IGF1)
   04152 AMPK signaling pathway
    107545147 (IGF1)
   04150 mTOR signaling pathway
    107545147 (IGF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107545147 (IGF1)
   04115 p53 signaling pathway
    107545147 (IGF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107545147 (IGF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    107545147 (IGF1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    107545147 (IGF1)
   04914 Progesterone-mediated oocyte maturation
    107545147 (IGF1)
   04935 Growth hormone synthesis, secretion and action
    107545147 (IGF1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107545147 (IGF1)
  09156 Nervous system
   04730 Long-term depression
    107545147 (IGF1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107545147 (IGF1)
  09149 Aging
   04211 Longevity regulating pathway
    107545147 (IGF1)
   04213 Longevity regulating pathway - multiple species
    107545147 (IGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107545147 (IGF1)
   05202 Transcriptional misregulation in cancer
    107545147 (IGF1)
   05205 Proteoglycans in cancer
    107545147 (IGF1)
  09162 Cancer: specific types
   05214 Glioma
    107545147 (IGF1)
   05218 Melanoma
    107545147 (IGF1)
   05215 Prostate cancer
    107545147 (IGF1)
   05224 Breast cancer
    107545147 (IGF1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107545147 (IGF1)
   05414 Dilated cardiomyopathy
    107545147 (IGF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107545147 (IGF1)
   01522 Endocrine resistance
    107545147 (IGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mna04052]
    107545147 (IGF1)
Cytokines and growth factors [BR:mna04052]
 Growth factors
  Growth factors (RTK binding)
   107545147 (IGF1)
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 107545147
NCBI-ProteinID: XP_016078698
LinkDB
Position
Unknown
AA seq 153 aa
MGKTSSLPTQLFKCSFCDSLKVKVHIMSSSHLFYLALCLLTLASPASAGPETLCGAELVD
ALQFVCGDRGFYFNKPTGYGSTSRRAPQIGIVDECCFRSCDLRRLEMYCAPLKPAKAARS
VRAQRHTDVPKAQKEVHLKNTSRGNAGNKNYRM
NT seq 462 nt   +upstreamnt  +downstreamnt
atggggaaaaccagcagccttccaacccaattatttaagtgcagcttctgtgattccttg
aaggtcaaggtgcacatcatgtcgtcgtcgcatctcttctacctggccctgtgcctgctc
accttggccagccccgcctcggctgggccggagacgctgtgcggggccgagctggtggac
gcgctgcagttcgtgtgcggagaccggggcttctacttcaacaagcccacagggtacggc
tccaccagtcggagggccccccagatcggcatcgtggacgagtgctgcttccggagctgc
gacctgagaaggctggagatgtactgcgcgcccctcaagcctgccaaggcggcccgctcc
gtccgcgcccagcgccacaccgacgtgcccaaggctcagaaggaagtacatttgaagaac
acaagtagagggaatgcgggaaataagaactacagaatgtag

DBGET integrated database retrieval system