KEGG   Moraxella ovis: MOVS_01620Help
Entry
MOVS_01620        CDS       T04329                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
moi  Moraxella ovis
Brite
KEGG Orthology (KO) [BR:moi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MOVS_01620
Enzymes [BR:moi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     MOVS_01620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 HI0933_like GIDA FAD_oxidored FAD_binding_2 NAD_binding_8 DAO Thi4 AlaDh_PNT_C NAD_binding_7 Glutaredoxin K_oxygenase NAD_binding_9 FAD_binding_3 3HCDH_N Lycopene_cycl DSBA
Motif
Other DBs
NCBI-ProteinID: ANB90908
UniProt: A0A160GDH2
LinkDB All DBs
Position
324653..326209
Genome map
AA seq 518 aa AA seqDB search
MLDQSLLDAVKTYSANMTCPIQMILGQGEHAKRAELIDFLEKIASTSDKIGFDKSVVDTD
LSAMSFKIATDNRDTGIVFSGIPGGHEFTSLLLAILHAGGHTMKLDEGIQDLVKRIQKPL
KFQTFVSLSCHNCPDVVQALNQFAVLNDGIENEMIDGGVFPELVEANNIQGVPAVFLNGK
PFLNGKVDTARIIDKLQAEYPDLLSEGVAEELETQDVTVIGGGPAGSAAAIYTARKGLRV
ALVADRIGGQVKDTQDIENLISIPLTNGNTLASNLSTHIKEYNITVKEHVSVSSIEEVKG
GYQVTLNTGASWTSRTLIIATGAKWRKLGVKGEDENIGNGVAYCPHCDGPFFKGKPVAVI
GGGNSGVEAALDLAGIVEHVTVLEFGDKLRADQVLIDKAEARDNITIIKNAATQEITANS
GKVDSLIYQDRASGENVTLPLSAVFVQIGLVPNSDVVKDLVDVTAHGEIEIDAKCRTNKP
GMFACGDVTTVPFKQINIAMGEGSKAGLAAFEYLMMNS
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgttagaccaatcattattagatgctgttaaaacgtacagcgccaacatgacttgtccg
attcagatgattctgggtcaaggtgagcacgccaaacgtgctgagctgattgattttctt
gaaaaaatcgccagcacctctgataagatcggctttgataagagtgttgtggataccgac
ctatctgcgatgagctttaaaattgccaccgataatcgcgataccggtattgtgtttagc
ggtatccctggtggtcatgaattcacgtcactactgcttgcgattttgcatgctggtggt
cacaccatgaagctagacgaaggcattcaagaccttgttaagcgaatccaaaaaccatta
aaattccaaactttcgtgtcgctgtcttgccataactgcccagatgtcgtacaggcattg
aatcagtttgccgtactgaacgatggcatcgaaaacgagatgattgacggtggtgtgttc
ccagagcttgtagaagctaacaacattcaaggcgtgcctgcggtattcctaaatggcaaa
ccattcctaaacggtaaagtggacaccgcgcgtatcatcgataagctacaagctgaatac
cctgatctgctgtctgagggcgtggccgaagaattagaaacccaagacgtgaccgtcatc
ggtggcggtcctgcaggttcggcagctgccatctataccgctcgtaagggtctgcgcgtg
gctctagtggctgatcgtattggcggtcaggttaaagacactcaagacattgagaatcta
atctcaatcccattaaccaatggtaatacgctagctagcaacctatccacgcacatcaaa
gaatacaacatcaccgtcaaagagcacgtgagcgtatcaagtattgaagaagtgaagggt
ggctatcaagttaccctaaacacgggtgcaagctggacgtcacgcacactaatcatcgca
acaggcgccaaatggcgtaagcttggtgttaaaggcgaagatgagaacatcggcaatggc
gtggcgtactgcccacactgtgatggcccattcttcaagggtaagcctgtggcggttatc
ggcggcggcaactctggtgttgaagcagcgcttgatttggcgggtatcgttgagcatgtg
accgtactagagtttggtgataagcttcgtgctgaccaagtactgatcgataaagctgaa
gcgcgtgataatatcactatcatcaaaaatgccgccactcaagaaatcaccgctaatagt
ggtaaagtggatagcctaatctatcaagaccgagcgagtggcgagaacgtgacgttgcca
ttgtcagcggtgtttgtgcagattggtctggtgccaaactctgatgtggttaaggacttg
gtggatgtgacagctcatggcgagattgagattgatgccaaatgtcgcaccaataagcca
ggcatgttcgcatgtggtgacgtgacaaccgtaccatttaagcaaatcaacatcgccatg
ggcgaaggttcaaaagcaggcttggcagcgtttgaatatctgatgatgaattcttaa

DBGET integrated database retrieval system