KEGG   Microbacterium oleivorans: BWL13_01932Help
Entry
BWL13_01932       CDS       T05832                                 

Gene name
fucA
Definition
(GenBank) L-fuculose phosphate aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
moo  Microbacterium oleivorans
Pathway
moo00051  Fructose and mannose metabolism
moo01100  Metabolic pathways
moo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:moo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BWL13_01932 (fucA)
Enzymes [BR:moo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BWL13_01932 (fucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II DUF5130
Motif
Other DBs
NCBI-ProteinID: AZS44345
UniProt: A0A031FPQ5
LinkDB All DBs
Position
1959889..1960563
Genome map
AA seq 224 aa AA seqDB search
MTTTSHHHDLRTSVAAASRTLAGHGLLIGTAGNVSAREGDVVAVTATGVVLADATLDDVT
VVDLDGAVIEGTLAPTSELALHLGVLRSAPPENVSAVVHTHAPNATALSLVLDELPVVHY
QQLILGGPLRVAPFHAFGTPELAAAVGAALDGRLAALMANHGTVALGPNLATAIEHALLV
EWLAELYLRAATVGTPRSLDGAQQHAVIAHATRLGYGATKPVTA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgacgtcgcaccatcatgacctccgcacgtctgtggccgcggcatcccgcacc
ctcgccggtcacggactcctcatcggcaccgccggaaacgtcagtgcgcgcgagggcgac
gtcgtggctgtcacggcgacgggcgtggtcctggccgacgccactctcgacgacgtcacc
gtggtcgatctcgacggcgctgtgatcgagggcaccctcgccccgacgtcggagctcgcg
ctgcacctcggagtgctgcggtccgcgccgcccgagaacgtgtcggccgtggtccacacg
catgcgccgaacgcgacggcgctgtcgctcgtcctcgacgagcttcccgtcgtgcactac
cagcagctcatcctcggcggtccgctccgcgtcgcgcccttccatgccttcggcactccc
gaactcgccgccgccgtcggcgccgcactcgacggccgcctcgctgctctgatggccaat
cacggcacggtcgcgctggggccgaacctcgccaccgcgatcgagcacgcgctgctggtc
gaatggctcgccgagctgtacctgcgcgcggcgaccgtcggcactccccgctcactcgac
ggcgcacagcagcacgccgtcatcgcgcacgccacacgcctcggctacggcgcgacgaag
ccggtgacggcatga

DBGET integrated database retrieval system