KEGG   Mesorhizobium opportunistum: Mesop_3544Help
Entry
Mesop_3544        CDS       T01542                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mop  Mesorhizobium opportunistum
Pathway
mop00473  D-Alanine metabolism
mop00550  Peptidoglycan biosynthesis
mop01100  Metabolic pathways
mop01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mop00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Mesop_3544
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Mesop_3544
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Mesop_3544
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mop01011]
    Mesop_3544
Enzymes [BR:mop01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Mesop_3544
Peptidoglycan biosynthesis and degradation proteins [BR:mop01011]
 Precursor biosynthesis
  Amino acid ligase
   Mesop_3544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp_3 CPSase_L_D2 GARS_A
Motif
Other DBs
NCBI-ProteinID: AEH87986
UniProt: F7YFV5
LinkDB All DBs
Position
3651616..3652542
Genome map
AA seq 308 aa AA seqDB search
MKSKHVAVLLGGFSSERPVSLSSGKACADELEKEGYQVTRVDVGRDVGSVLAELKPDVAF
NALHGPFGEDGTIQGILEYLAIPYTHSGVLASALAMNKEQAKRVAKSVGTPVAESKVTSR
FAIQDKHPMKPPYVVKPVSEGSSFGVVIVSEGQSHPPQVIGSSEWKYGDTVMVERYIHGR
ELTCAVMGDVALGVCEIIPTGHSFYDYDSKYVAGGSKHECPAKVSPNIYQKIQTLALKAH
QVIGCRGVSRSDFRYDDRHSENGEVVWLEVNTQPGMTPTSLVPEIAAHAGHSFGDLLSWM
VEDASCLR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcaagcatgtggccgtactgctgggaggtttctcgtccgagcggcccgtgtcc
ctgtcctcgggaaaggcttgcgccgatgagctcgagaaagaaggctaccaggtcacgcgt
gtcgatgtcgggcgcgatgtcggctcggtgctcgccgaactcaagcccgatgtcgctttc
aatgcgctgcatggtccgttcggcgaggatggcacaatccagggcatcctcgaatatctc
gccattccctacacccattcgggcgtgctcgcctcggcgttggccatgaacaaggagcag
gccaagcgagttgccaaatcggtcggcacgcctgtcgccgaatcgaaggtcaccagccgc
ttcgccatccaggacaagcatccgatgaagccgccctatgtggtcaaaccggtcagcgag
ggctcgagcttcggtgtcgtcatcgtcagcgagggccagtcgcatccgccgcaggtcatc
ggttcgtccgagtggaaatatggcgataccgtcatggtcgagcgctacatccacggccgg
gagctgacctgtgcggtgatgggcgatgtcgcgctcggggtctgcgagatcatcccgacc
ggccattccttctacgactatgattcaaaatatgtcgctggcggatcaaagcacgaatgc
cccgcaaaagtttcaccgaatatttaccaaaaaatacaaacactggcgctcaaggctcac
caagtgatcggctgtcggggcgtttcccggtcggacttccgttatgacgatcgtcactcc
gaaaatggcgaggttgtatggctcgaggtcaatacccaaccgggcatgacaccgacgtcc
ttggtgcctgaaatcgctgcccatgccgggcactcgtttggcgatctgttgagttggatg
gtggaggacgcttcgtgtctgcgttga

DBGET integrated database retrieval system