KEGG   Moraxella osloensis: AXE82_09425Help
Entry
AXE82_09425       CDS       T04294                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mos  Moraxella osloensis
Brite
KEGG Orthology (KO) [BR:mos00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AXE82_09425
Enzymes [BR:mos01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AXE82_09425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored Thi4 FAD_binding_2 NAD_binding_8 DAO HI0933_like NAD_binding_7 AlaDh_PNT_C FAD_binding_3 K_oxygenase Lycopene_cycl Glutaredoxin NAD_Gly3P_dh_N 3HCDH_N HCBP_related zinc_ribbon_9 Shikimate_DH Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: AME01949
UniProt: A0A378QBA2
LinkDB All DBs
Position
2135814..2137397
Genome map
AA seq 527 aa AA seqDB search
MLDQGLLDAVKSYSERMTRPIEFVLGEGEHEQRAELVDFLTQIAGTTDKIRLSQQFDANL
SPMSFKIRSQDKDTGIIFSGIPGGHEFTSLILAILQSGGSEIKLDPGIQNIIKAIKQPLK
FETFVSLSCHNCPDVVQALNQFALLNDNISNEMIDGGVFQDMINERNIQGVPAVYLNGKP
FANGKIDTAKLIEKLQQQYPDLMSGAAAAEQLEQQDVTIIGGGPAGVAAAIYVARKGLKV
TMVADRIGGQVKDTQDIENLISIPLTNGNELSANFVKHIAAYSITVKEMVSVTSISENSA
QMNEQGEDKPTYQITLNTGESFGTRAIIVATGAKWRKLNIKGEDENIGSGVAYCPHCDGP
FFKGKDVAVVGGGNSGIEAAIDLAGIVKHVTVLEFADTLKADQVLIDKAKERDNIDIMTS
VASQEIKATDGKVSSLIYQDRTTGENKELPLSAIFVQIGLVPNSEVVKDLVQVTKFGEIE
INEKCQTNKPGIFACGDVTTVPFKQINIAMGEGSKAALSAFEYLMLQ
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgttagatcaaggtttattagatgcagtaaaaagttatagcgaacgtatgactcgcccg
attgagtttgtgttgggtgagggtgaacatgaacagcgcgctgaactggtggattttttg
acccaaattgcaggaaccactgacaagattcgtttgagtcaacaattcgatgccaatcta
tcaccgatgagttttaaaatccgtagccaagacaaagatacaggtatcatttttagtggt
attccaggtggtcacgaatttacctcattgattttggcgattttacaatcaggtggtagt
gaaatcaaacttgacccaggtattcaaaatattattaaggcgattaaacagccgctaaaa
tttgaaactttcgtctcattgtcttgccacaactgtccagacgtggtacaagcgctgaac
caatttgcgttattgaacgacaacatcagcaatgaaatgattgatggtggtgtgttccaa
gacatgattaacgagcgcaatatccaaggcgtacctgcggtatatttaaatggtaaacct
tttgccaatggtaaaattgacactgccaaactcattgagaaactgcaacagcaatatcca
gatttgatgagtggtgcagcagcagccgaacagcttgagcagcaagatgtaaccatcatc
ggtggcggacctgcgggcgtagcggcagccatttatgtggcacgtaaaggcttaaaagtg
accatggtggctgatcgtatcggtgggcaagtgaaagatacccaagatatcgaaaacttg
atttcaatcccgttgaccaatggtaatgaattatctgccaattttgtcaaacatattgcc
gcttatagtatcacggtcaaagaaatggtaagcgtgacatccatcagcgaaaattctgca
caaatgaatgagcaaggcgaggataagccaacctaccaaattaccttgaataccggtgaa
agttttggcactcgtgcgattatcgtagcgacgggggcaaaatggcgtaagcttaacatc
aaaggtgaagacgaaaatatcggtagtggcgtcgcatattgtccgcactgtgatggtccg
ttctttaaaggcaaagacgtggcagttgtgggcggcggtaactcagggattgaagcggca
attgacttggcaggcattgtcaaacacgtgacagtgttagaatttgctgacacgctcaaa
gcagaccaagtattgattgataaagccaaagagcgcgataatatcgatatcatgacaagt
gtagcgagccaagagattaaagcaactgatggtaaagtcagttcgctaatttaccaagac
cgtaccaccggtgaaaacaaagaattgccattatctgctatctttgtgcaaatcggactg
gtgccaaactcggaagtggtcaaagatttggtacaggtgaccaaatttggtgaaatcgaa
atcaatgagaaatgccaaaccaacaaacccggaatttttgcctgtggtgatgtcactacc
gtaccgtttaagcaaattaatattgcgatgggcgaaggtagtaaagcggcactcagtgcg
tttgaatacctcatgttgcaataa

DBGET integrated database retrieval system