KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP_1041cHelp
Entry
MAP_1041c         CDS       T00156                                 

Gene name
gabT
Definition
(GenBank) GabT
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
mpa00250  Alanine, aspartate and glutamate metabolism
mpa00280  Valine, leucine and isoleucine degradation
mpa00410  beta-Alanine metabolism
mpa00640  Propanoate metabolism
mpa00650  Butanoate metabolism
mpa01100  Metabolic pathways
mpa01120  Microbial metabolism in diverse environments
Module
mpa_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mpa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MAP_1041c (gabT)
   00650 Butanoate metabolism
    MAP_1041c (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MAP_1041c (gabT)
   00280 Valine, leucine and isoleucine degradation
    MAP_1041c (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MAP_1041c (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mpa01007]
    MAP_1041c (gabT)
Enzymes [BR:mpa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     MAP_1041c (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     MAP_1041c (gabT)
Amino acid related enzymes [BR:mpa01007]
 Aminotransferase (transaminase)
  Class III
   MAP_1041c (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AAS03358
UniProt: Q741P8
LinkDB All DBs
Position
complement(1088462..1089811)
Genome map
AA seq 449 aa AA seqDB search
MARLEQTRRLVTEIPGPASLELSKRRAAAVSHAVNVSVPVFVARAGGGIVEDVDGNRLID
LGSGIAVTTIGNSAPRVVDAVRAQVAEFTHTCFMVTPYESYVAVAEMLNRITPGAGDKRS
VLFNSGAEAVENAVKVARAYTRKPAVVAFDHAYHGRTNLAMALTAKSMPYKGGFGPFAPE
IYRAPLSYPYRDGLLDKELATDGEKAAARAINIIDGQIGADSLAAVIIEPIQGEGGFIVP
VEGFLPTLLDWCRRNDVLFIADEVQTGFARSGAMFACEHEGPNGLEPDLICTAKAIADGL
PLSAVTGRAQIMDAPHVGGLGGTFGGNPLACAAALATIETIESDGLIERARQLERLITEP
LLRLQARDDRIGDVRGRGAMIAIELVKSGTAEPDKDLTQRLSVAAHAAGVIVLTCGMFGN
IIRLLPPLTISDELLAEGIDILGGLLADL
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtggccaggctcgagcagactcgccggctggtcaccgagatccccggcccggcgtcgctg
gagctgagcaaacgccgcgcggcggcggtgtcgcacgcggtcaacgtgtcggtgccggtg
ttcgtcgcccgcgccggcggcggcatcgtcgaggacgtcgacggcaaccggctcatcgac
ctcggctccggcatcgcggtgaccaccatcggcaactcggcgccccgggtggtcgacgcg
gtgcgcgcccaggtggccgagttcacccacacctgcttcatggtgacgccgtacgagtcc
tacgtcgccgtcgccgaaatgctgaaccggatcacccccggtgccggtgacaagcgctcg
gtgctgttcaactccggcgccgaggccgtcgagaacgccgtcaaggtcgcccgcgcctac
acccgtaagccggccgtggtggccttcgaccacgcctaccacggccgcaccaacctggcg
atggcgctgaccgcgaagtcgatgccctacaagggcggcttcggcccgttcgcgccggag
atctaccgggcgccgctgtcctacccctaccgggacgggctgctcgacaaggaactggcc
accgacggggagaaggccgccgcgcgggccatcaacatcatcgacggccagatcggcgcc
gacagcctggccgcggtgatcatcgaaccgatccagggcgagggcgggttcatcgttccc
gtcgaaggattcctgcccaccctgctggactggtgccgccgcaacgacgtgctgttcatc
gccgacgaggtgcagaccgggttcgcgcggtccggcgccatgttcgcctgcgagcacgag
ggcccgaatggtttagagccggacctgatctgcaccgccaaggccatcgccgacgggctg
ccgctgtcggcggtcaccggccgcgcccagatcatggacgccccgcacgtcgggggcctg
ggcggcaccttcggcggcaacccgctggcgtgcgcggcggcgctggccaccatcgagacg
atcgagagcgacggcctgatcgaacgggcccggcagctggaacgcctgatcaccgaaccg
ctgctgcgcctgcaggcccgcgacgaccggatcggcgacgtccgcggccggggcgccatg
atcgccatcgaactggtgaagtccggcaccgccgagccggacaaggacctgacccagcgg
ctgtccgtcgccgcgcacgcggccggcgtcatcgtgctcacctgcggcatgttcggcaac
atcatccggctgctgccgccgctgaccatcagcgacgagctgctcgccgagggcatcgac
attctcggcgggttgttggccgacctgtaa

DBGET integrated database retrieval system