KEGG   Mus pahari (shrew mouse): 110316550
Entry
110316550         CDS       T05929                                 

Gene name
Gadd45a
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha isoform X1
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
mpah04064  NF-kappa B signaling pathway
mpah04068  FoxO signaling pathway
mpah04110  Cell cycle
mpah04115  p53 signaling pathway
mpah04210  Apoptosis
mpah04218  Cellular senescence
mpah05169  Epstein-Barr virus infection
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05210  Colorectal cancer
mpah05212  Pancreatic cancer
mpah05213  Endometrial cancer
mpah05214  Glioma
mpah05216  Thyroid cancer
mpah05217  Basal cell carcinoma
mpah05218  Melanoma
mpah05220  Chronic myeloid leukemia
mpah05222  Small cell lung cancer
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110316550 (Gadd45a)
   04064 NF-kappa B signaling pathway
    110316550 (Gadd45a)
   04068 FoxO signaling pathway
    110316550 (Gadd45a)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110316550 (Gadd45a)
   04210 Apoptosis
    110316550 (Gadd45a)
   04115 p53 signaling pathway
    110316550 (Gadd45a)
   04218 Cellular senescence
    110316550 (Gadd45a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110316550 (Gadd45a)
   05202 Transcriptional misregulation in cancer
    110316550 (Gadd45a)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110316550 (Gadd45a)
   05212 Pancreatic cancer
    110316550 (Gadd45a)
   05225 Hepatocellular carcinoma
    110316550 (Gadd45a)
   05226 Gastric cancer
    110316550 (Gadd45a)
   05214 Glioma
    110316550 (Gadd45a)
   05216 Thyroid cancer
    110316550 (Gadd45a)
   05220 Chronic myeloid leukemia
    110316550 (Gadd45a)
   05217 Basal cell carcinoma
    110316550 (Gadd45a)
   05218 Melanoma
    110316550 (Gadd45a)
   05213 Endometrial cancer
    110316550 (Gadd45a)
   05224 Breast cancer
    110316550 (Gadd45a)
   05222 Small cell lung cancer
    110316550 (Gadd45a)
   05223 Non-small cell lung cancer
    110316550 (Gadd45a)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    110316550 (Gadd45a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mpah03036]
    110316550 (Gadd45a)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     110316550 (Gadd45a)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     110316550 (Gadd45a)
SSDB
Motif
Pfam: Ribosomal_L7Ae XPA_C
Other DBs
NCBI-GeneID: 110316550
NCBI-ProteinID: XP_021046582
Ensembl: MGP_PahariEiJ_G0022207
LinkDB
Position
2
AA seq 165 aa
MTLEEFSAAEQKTERMDTVGDALEEVLSKARSQRTITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIRAFCCENDINILRVSNPGRLAELLLLENDAGPAESGGAAQTP
DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER
NT seq 498 nt   +upstreamnt  +downstreamnt
atgactttggaggaattctcggctgcagagcagaagaccgaaaggatggacacggtgggc
gatgccctggaggaagtgctcagcaaggctcggagtcagcgcaccattaccgtcggcgtg
tacgaggctgccaagctgctcaacgtagaccccgataacgtggtactgtgcctgctggct
gcggacgaagacgacgaccgggacgtggctctgcagatccatttcaccctcatccgtgcg
ttctgctgcgagaacgacatcaacatcctgcgggtcagcaacccgggtcggctagctgag
ctgctgctactggagaacgacgcgggcccggcggagagcgggggcgctgcgcagaccccg
gacctgcactgtgtgctggtgacgaacccacattcatcacaatggaaggatcctgcctta
agtcaacttatttgtttttgccgggaaagtcgctacatggatcagtgggtgcccgtgatt
aatctccccgagcggtga

KEGG   Mus pahari (shrew mouse): 110326839
Entry
110326839         CDS       T05929                                 

Gene name
Gadd45b
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
mpah04064  NF-kappa B signaling pathway
mpah04068  FoxO signaling pathway
mpah04110  Cell cycle
mpah04115  p53 signaling pathway
mpah04210  Apoptosis
mpah04218  Cellular senescence
mpah05169  Epstein-Barr virus infection
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05210  Colorectal cancer
mpah05212  Pancreatic cancer
mpah05213  Endometrial cancer
mpah05214  Glioma
mpah05216  Thyroid cancer
mpah05217  Basal cell carcinoma
mpah05218  Melanoma
mpah05220  Chronic myeloid leukemia
mpah05222  Small cell lung cancer
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110326839 (Gadd45b)
   04064 NF-kappa B signaling pathway
    110326839 (Gadd45b)
   04068 FoxO signaling pathway
    110326839 (Gadd45b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110326839 (Gadd45b)
   04210 Apoptosis
    110326839 (Gadd45b)
   04115 p53 signaling pathway
    110326839 (Gadd45b)
   04218 Cellular senescence
    110326839 (Gadd45b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110326839 (Gadd45b)
   05202 Transcriptional misregulation in cancer
    110326839 (Gadd45b)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110326839 (Gadd45b)
   05212 Pancreatic cancer
    110326839 (Gadd45b)
   05225 Hepatocellular carcinoma
    110326839 (Gadd45b)
   05226 Gastric cancer
    110326839 (Gadd45b)
   05214 Glioma
    110326839 (Gadd45b)
   05216 Thyroid cancer
    110326839 (Gadd45b)
   05220 Chronic myeloid leukemia
    110326839 (Gadd45b)
   05217 Basal cell carcinoma
    110326839 (Gadd45b)
   05218 Melanoma
    110326839 (Gadd45b)
   05213 Endometrial cancer
    110326839 (Gadd45b)
   05224 Breast cancer
    110326839 (Gadd45b)
   05222 Small cell lung cancer
    110326839 (Gadd45b)
   05223 Non-small cell lung cancer
    110326839 (Gadd45b)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    110326839 (Gadd45b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mpah03036]
    110326839 (Gadd45b)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     110326839 (Gadd45b)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     110326839 (Gadd45b)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 110326839
NCBI-ProteinID: XP_021061105
Ensembl: MGP_PahariEiJ_G0031025
LinkDB
Position
9
AA seq 160 aa
MTLEELVASDSAVQKMQAVTAAVEQLLVAAQRQDRLTVGVYEAAKLMNVDPDSVVLCLLA
IDEEEEDDIALQIHFTLIQSFCCDNDIDIVRVSGMQRLAQLLGEPAETLGTTEARDLHCL
LVTNCHTDSWKSQGLVEVASYCEESRGNNQWVPYISLEER
NT seq 483 nt   +upstreamnt  +downstreamnt
atgaccctggaagagctggtggcgagcgacagcgcggttcagaagatgcaggcggtgact
gctgcggtggagcagctgctggtggccgcgcagcgtcaggatcgcctcaccgtgggggtg
tacgaggcggccaaactgatgaatgtggaccccgacagcgtggtcttgtgcctcctggcc
atagacgaagaagaggaggatgatatcgctctgcagattcacttcaccctgatccagtcg
ttctgctgcgacaatgacattgacatcgtccgggtatcaggcatgcagaggctggctcag
ctcctgggggagccggcagagacactgggcacaaccgaggcacgagacctgcactgcctc
ctggtcacgaactgtcatacagattcctggaaaagccaaggcttggtggaggtggccagt
tactgtgaagagagcagaggcaataaccaatgggtgccctatatctctctggaggaacgc
tga

KEGG   Mus pahari (shrew mouse): 110333844
Entry
110333844         CDS       T05929                                 

Gene name
Gadd45g
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
mpah04064  NF-kappa B signaling pathway
mpah04068  FoxO signaling pathway
mpah04110  Cell cycle
mpah04115  p53 signaling pathway
mpah04210  Apoptosis
mpah04218  Cellular senescence
mpah05169  Epstein-Barr virus infection
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05210  Colorectal cancer
mpah05212  Pancreatic cancer
mpah05213  Endometrial cancer
mpah05214  Glioma
mpah05216  Thyroid cancer
mpah05217  Basal cell carcinoma
mpah05218  Melanoma
mpah05220  Chronic myeloid leukemia
mpah05222  Small cell lung cancer
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110333844 (Gadd45g)
   04064 NF-kappa B signaling pathway
    110333844 (Gadd45g)
   04068 FoxO signaling pathway
    110333844 (Gadd45g)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    110333844 (Gadd45g)
   04210 Apoptosis
    110333844 (Gadd45g)
   04115 p53 signaling pathway
    110333844 (Gadd45g)
   04218 Cellular senescence
    110333844 (Gadd45g)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110333844 (Gadd45g)
   05202 Transcriptional misregulation in cancer
    110333844 (Gadd45g)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110333844 (Gadd45g)
   05212 Pancreatic cancer
    110333844 (Gadd45g)
   05225 Hepatocellular carcinoma
    110333844 (Gadd45g)
   05226 Gastric cancer
    110333844 (Gadd45g)
   05214 Glioma
    110333844 (Gadd45g)
   05216 Thyroid cancer
    110333844 (Gadd45g)
   05220 Chronic myeloid leukemia
    110333844 (Gadd45g)
   05217 Basal cell carcinoma
    110333844 (Gadd45g)
   05218 Melanoma
    110333844 (Gadd45g)
   05213 Endometrial cancer
    110333844 (Gadd45g)
   05224 Breast cancer
    110333844 (Gadd45g)
   05222 Small cell lung cancer
    110333844 (Gadd45g)
   05223 Non-small cell lung cancer
    110333844 (Gadd45g)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    110333844 (Gadd45g)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mpah03036]
    110333844 (Gadd45g)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     110333844 (Gadd45g)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     110333844 (Gadd45g)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 110333844
NCBI-ProteinID: XP_021071249
Ensembl: MGP_PahariEiJ_G0019587
LinkDB
Position
16
AA seq 159 aa
MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFC
VLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGANEEGGAPGDLHCI
LISNPNEDTWKDPALEKLSLFCEESRSFNDWVPSITLPE
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactctggaagaagtccgtggccaggatacagttccggaaagcacagccaggatgcag
ggcgccgggaaagcactgcacgaacttctgctgtcggcgcagcgccagggctgtctgacc
gctggcgtctacgagtccgccaaagtcctgaatgtggaccctgacaatgtgaccttttgc
gtgctggctgccgatgaagaagatgagggcgacatagcgctgcagatccatttcacgttg
atccaagcgttctgctgtgagaacgacattgatatcgtgcgcgtgggagacgtgcagagg
ctggcggcgatcgtgggcgccaacgaagaggggggcgcgccgggagacctgcattgcatc
ctcatttcgaatcctaatgaggacacatggaaggaccctgccttggagaagctcagtttg
ttctgcgaggagagccgcagcttcaacgactgggtgcccagcatcacccttcccgagtga

DBGET integrated database retrieval system