KEGG   Mus pahari (shrew mouse): 110320556
Entry
110320556         CDS       T05929                                 

Gene name
Il2
Definition
(RefSeq) interleukin-2
  KO
K05429  interleukin 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04061  Viral protein interaction with cytokine and cytokine receptor
mpah04151  PI3K-Akt signaling pathway
mpah04625  C-type lectin receptor signaling pathway
mpah04630  JAK-STAT signaling pathway
mpah04658  Th1 and Th2 cell differentiation
mpah04659  Th17 cell differentiation
mpah04660  T cell receptor signaling pathway
mpah04672  Intestinal immune network for IgA production
mpah04940  Type I diabetes mellitus
mpah05135  Yersinia infection
mpah05142  Chagas disease
mpah05162  Measles
mpah05166  Human T-cell leukemia virus 1 infection
mpah05200  Pathways in cancer
mpah05320  Autoimmune thyroid disease
mpah05321  Inflammatory bowel disease
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110320556 (Il2)
   04151 PI3K-Akt signaling pathway
    110320556 (Il2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110320556 (Il2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    110320556 (Il2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110320556 (Il2)
   04660 T cell receptor signaling pathway
    110320556 (Il2)
   04658 Th1 and Th2 cell differentiation
    110320556 (Il2)
   04659 Th17 cell differentiation
    110320556 (Il2)
   04672 Intestinal immune network for IgA production
    110320556 (Il2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110320556 (Il2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110320556 (Il2)
   05321 Inflammatory bowel disease
    110320556 (Il2)
   05330 Allograft rejection
    110320556 (Il2)
   05332 Graft-versus-host disease
    110320556 (Il2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110320556 (Il2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110320556 (Il2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110320556 (Il2)
   05162 Measles
    110320556 (Il2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110320556 (Il2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mpah04052]
    110320556 (Il2)
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110320556 (Il2)
Cytokines and growth factors [BR:mpah04052]
 Cytokines
  Interleukins
   110320556 (Il2)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Haparin
  Cytokines
   110320556 (Il2)
SSDB
Motif
Pfam: IL2 DUF3446 OGG_N
Other DBs
NCBI-GeneID: 110320556
NCBI-ProteinID: XP_021052288
Ensembl: MGP_PahariEiJ_G0026385
LinkDB
Position
4
AA seq 166 aa
MYSMQLASCVALTLVFLVNSAPTSSPTSSSTSSSTAEAQQQQQHLEQLLMDLQELLSRME
NYRNLKLPRMLTFKFYLPKQATELKDLQCLEDELGALQRVLDLTQSKSFQLEDAENFISN
IRVTVIKLKGSENTLECQFADESVTVVEFLRRWIAFCQSIISARPQ
NT seq 501 nt   +upstreamnt  +downstreamnt
atgtacagcatgcagctcgcatcctgtgtcgcactgacacttgtgttccttgtcaacagt
gcacccacttcaagccccacttcaagttccacttcaagctctacagcggaagcacagcag
cagcagcagcacctggagcagctgttgatggacctacaggagctcttgagcaggatggag
aattacaggaacctgaaactccccaggatgctcaccttcaaattttacttgcccaagcag
gccacagaattgaaagatcttcagtgcctagaagatgaactcggagctctgcagcgtgtg
ctggatttgactcaaagcaaaagctttcaattggaagatgctgagaatttcatcagtaat
atcagagtaactgttataaaactaaagggctctgaaaacacacttgagtgccaatttgct
gatgagtcagtgactgtggtggaatttctgaggagatggatagccttctgtcaaagcatc
atctcagcaaggcctcaataa

DBGET integrated database retrieval system