KEGG   Mus pahari (shrew mouse): 110321218
Entry
110321218         CDS       T05929                                 

Gene name
Cacna1e
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X1
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
mpah04020  Calcium signaling pathway
mpah04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110321218 (Cacna1e)
   04020 Calcium signaling pathway
    110321218 (Cacna1e)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110321218 (Cacna1e)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mpah04040]
    110321218 (Cacna1e)
Ion channels [BR:mpah04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   110321218 (Cacna1e)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 110321218
NCBI-ProteinID: XP_021053019
Ensembl: MGP_PahariEiJ_G0027956
LinkDB
Position
5
AA seq 2315 aa
MARFGEAVVVGRPGSGDGDSDQSRNRQGTPVPASGPAAAYKQSKAQRARTMALYNPIPVR
QNCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTP
MSRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTH
FNTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIG
LEFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGYECKDWIGPNDGITQFDNILFAV
LTVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERE
RVENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNSGTSALEVLRRATIKRSR
TEAMTRDSSDEHCVDISSVGTPLARASIKSTKVDGASYFRHKERLLRISIRHMVKSQVFY
WIVLSVVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSS
FNCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSS
MKSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDW
NEVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEE
EEAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWE
QRTSQLRRHMQMSSQEALNKEEAPPMNPLNPLNPLSPLNPLNAHPSLYRRPRPIEGLALG
LGLEKCEEERISRGGSLKGDIGGLTSALDNQRSPLSLGKREPPWLPRSCHGNCDPTQQEA
GGGETVVTFEDRARHRQSQRRSRHRRVRTEGKESASASRSRSASQERSLDEGVSIEGEKE
HEPHSSHRSKEPTIHEEERTQDLRRTNSLMVPRGSGLVGALDEAETPLVQPQPELEVGKD
AALTEQEAEGSSEQALLGDVQLDVGRGISQSEPDLSCMTANMDKATTESTSVTVAIPDVD
PLVDSTVVNISNKTDGEASPLKEAETKEEEEEVEKKKQKKEKRETGKAMVPHSSMFIFST
TNPIRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSERNKVLRYFDYVFTGVFT
FEMVIKMIDQGLILQDGSYFRDLWNILDFVVVVGALVAFALANALGTNKGRDIKTIKSLR
VLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYC
TDSSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVL
QHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECS
LEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMK
YYSAPCTYELALKYLNIAFTMVFSLECVLKVIAFGFLNYFRDTWNIFDFITVIGSITEII
LTDSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLF
FIYAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKGC
EPDTTAPSGQNEGERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGP
HHLDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVA
EDMTVHFTSTLMALIRTALDIKIAKGGADRQQLDSELQKETLAIWPHLSQKMLDLLVPMP
KASDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPMFQRMEPSSLPQEIIANAKAL
PYLQQDPVSGLSGRSGYPSMSPLSPQEIFQLACMDPADDGQFQEQQSLEPEVSELKSVQS
SNHGIYLPPDTQEHAGSGRASSMPRLTMDPQVVTDPSSMRRSFSTIRDKRSNSSWLEEFS
MERSSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTHRSGGRERGRSKERKHLLSPDVS
RCNSEERGTQAEWESPERRQSRSPSEGRSQTPNRQGTGSLSESSIPSISDTSTPRRSRRQ
LPPVPPKPRPLLSYSSLMRHTGGISPPPDGSEGGSPLASQALESNSACLTESSNSLHPQQ
GQHPSPQHYISEPYLALHEDSHASDCGEEETLTFEAAVATSLGRSNTIGSAPPLRHSWQM
PNGHYRRRRRGGPGPGMMCGAVSDLLSDTEEDDKC
NT seq 6948 nt   +upstreamnt  +downstreamnt
atggctcgcttcggggaggcggtggtcgttggcaggccaggctcaggcgatggagactcg
gaccagagcaggaaccgacaaggaacccccgtaccggcctcggggccggcggccgcctac
aagcagtcaaaagcgcagagggcgcggactatggctttgtacaaccccataccagtccgg
cagaactgtttcacggtcaacagatccctgttcatcttcggagaagataacattgtcagg
aaatacgccaagaagctcatcgattggccgccatttgagtacatgatcctggccaccatc
attgccaactgtatcgtcttggccctggagcagcatcttcctgaggatgacaagacccca
atgtctcgaagactggagaagacagaaccatatttcattgggatcttctgctttgaagct
gggatcaaaattgtggctctagggttcatcttccataagggttcataccttcgtaatggc
tggaatgtcatggactttatcgtggtccttagtggcatcctggccactgcgggaacccac
ttcaacacccacgtggaccttcggaccctccgggctgtgcgtgtcctgaggcctttaaag
ctggtgtcaggaatacctagcttgcagattgtgctgaagtctatcatgaaggccatggtg
cctcttctgcagattggccttctgctcttctttgccatcctcatgttcgccatcattggc
ttggagttctacagtggcaagttgcatcgagcatgcttcatgaacaattcaggtattcta
gagggattcgatcctcctcacccgtgtggtgttcagggctgcccggctggttatgaatgt
aaggactggatcggccccaatgacgggatcacccagtttgacaacatcctttttgccgtg
ctgactgtcttccaatgcatcactatggaagggtggaccactgtgctgtacaataccaat
gatgccttaggagccacctggaactggctgtatttcattcctctcatcatcatcggatcc
ttctttgttctcaacctcgtcctgggagtgctttctggggaatttgccaaagaaagagag
agagtggagaaccgaagagcgttcatgaagctccggcgccagcaacagattgagcgcgag
ttgaatggctaccgcgcctggatagacaaagcagaggaagtcatgcttgctgaagaaaat
aaaaactcgggaacatcagccttggaagtgcttcgaagggcaaccatcaaaaggagccgg
acggaggccatgacccgagactccagcgatgagcactgcgttgatatctcttcagtgggc
acacctcttgccagagccagtatcaagagcacaaaagtagacggggcctcctatttccgg
cacaaggaacggcttctgcgcatctctatccgccacatggtcaagtcccaagtcttttac
tggatcgtcctgagtgttgtggctcttaatactgcctgtgtggccattgttcatcacaac
cagccacaatggctcactcacctcctctactatgcagaatttttgtttctgggactcttc
ctgttggagatgtccctgaagatgtacggcatggggccacgcctttattttcactcatcc
ttcaactgctttgattttggggtcacagtgggcagcatctttgaggtcgtctgggcaatc
ttcagacctggaacatcttttggaatcagtgtcttacgagctctccggctcctaaggata
tttaaaataaccaagtattgggcatccctccggaatctggttgtctccttgatgagctcc
atgaagtctattatcagcttactcttcctcctcttcctcttcatcgttgtctttgctctc
ctgggaatgcagctctttggaggcaggtttaactttaatgatggaactccttcagctaat
tttgacaccttccctgcagctatcatgacagtgttccagatccttacaggggaagactgg
aatgaggtgatgtacaatggcattcgctcccagggtggggtcagctcaggcatgtggtct
gccatctacttcattgtgctcaccttgtttggaaactacacgctgctgaatgtcttcttg
gccattgcggtggacaatctggccaatgcccaggagctgactaaggatgagcaggaggaa
gaagaagccttcaaccagaaacatgcactgcagaaggccaaggaggtcagcccaatgtct
gctcccaacatgccttccattgaaagagacagaaggagaagacaccacatgtcgatgtgg
gagccacgcagcagccacctgagggagcggaggcgccggcaccacatgtctgtgtgggaa
cagcgcaccagccagctgaggaggcacatgcagatgtctagccaagaagccctcaacaaa
gaggaggccccaccgatgaaccccctcaatccactcaacccactgagtcctctcaacccc
ctcaatgctcaccccagcctctatcggaggcccaggcccattgagggcctagccctgggc
ctgggtcttgaaaagtgtgaagaggagcgcatcagccgtgggggttccctcaagggggac
atagggggtctgaccagcgccctggacaaccagaggagccccttgtccttgggcaaacga
gagccaccgtggctgcctagatcctgtcatggaaactgtgacccaacccagcaggaggct
gggggaggagagactgtggtgacttttgaggaccgggccaggcacaggcagagtcagagg
cgaagccggcatcgccgagtcaggactgagggcaaggagtctgcctctgcctcccgaagc
aggtctgccagccaggagcggagtctggatgaaggggtgtccatcgagggggagaaggaa
catgagcctcacagcagccacaggagcaaagagccgaccatccatgaagaggagagaacc
caggacttaaggaggaccaacagtctgatggtacccaggggctctggactggtaggggct
cttgatgaagcagaaacacctctagtccagccccaaccagagctggaagtggggaaagat
gcagctctgacagagcaggaggctgaaggcagcagtgaacaagcccttcttggggatgta
cagctggatgtgggccggggcattagccagagtgaaccggacctctcctgcatgacagcc
aacatggacaaggctaccacagagagcaccagtgtcacagtcgccatccctgatgtggac
cctttggtggactcaacagtggtgaacattagcaacaagacggatggagaagccagtccc
ttgaaggaggcagagactaaagaggaagaagaagaggtggagaagaagaagcagaagaag
gagaagcgggagactggcaaagccatggtgccccatagctctatgttcatcttcagcacc
actaacccgatccgcagggcctgccactacattgtgaacctacgctactttgaaatgtgc
attctcttggtgattgcggccagcagcattgccctggcagctgaggatcctgtcctaact
aactcggagcgtaacaaagtcctgagatatttcgactatgttttcacaggagtgtttacc
tttgagatggttataaagatgatagaccaaggcttgatcctgcaagatggatcgtacttc
cgagacctctggaacatcctggactttgtggtagtagttggtgcattggtagcattcgct
ctggcgaacgctttgggaaccaacaaagggcgggatatcaagactatcaaatctctgagg
gtacttcgagttctgcggccactgaaaaccatcaagcgcttacccaagctgaaggctgtg
tttgactgcgtggtgacctccttgaagaatgtcttcaacatactcattgtctacaagctc
tttatgttcatctttgccgtcattgctgttcagctattcaaaggaaagttcttttattgc
accgacagttccaaggacacagagaaggagtgcataggcaactatgtagaccatgagaaa
aacaagatggaggtaaagggccgggaatggaagcgtcatgaattccactatgacaacatc
atatgggctctgctgaccctcttcactgtctccacgggggaaggatggcctcaggttctg
cagcactctgtagacgtgacagaggaggacagaggcccaagtcgcagcaaccgcatggag
atgtccatcttttatgtggtctactttgtggtcttccctttcttctttgtcaatatcttt
gtggctctcattatcatcaccttccaggagcaaggggacaagatgatggaggaatgtagc
ctggagaagaatgagagggcatgcatcgacttcgccattagtgccaaacctcttacccgc
tacatgccacagaacagacacaccttccagtaccgtgtgtggcactttgtagtctctcca
tcctttgagtacaccatcatggccatgattgccttgaacactgtcgtgctgatgatgaag
tactattctgctccttgcacctatgagctcgccctaaagtacctgaacattgccttcact
atggtgttttccctggaatgtgtcctaaaggtcatcgctttcggcttcctgaactatttc
cgagatacctggaacatctttgacttcatcacggtgatcggcagtatcacagaaattatc
ctgacagacagcaagctggtgaacaccagtggcttcaatatgagctttctgaagctcttc
cgagctgcacggctcataaagcttctgagacagggctacacaatccgcatcttactgtgg
accttcgtgcagtcctttaaggctctcccctatgtctgccttctgattgccatgcttttc
ttcatctatgccatcattgggatgcaggtgtttggaaacataaagttagatgaggagagt
catatcaaccggcacaacaacttccgaagtttctttgggtccctcatgctgcttttcagg
agcgccactggggaggcttggcaggagattatgctgtcctgtctgggtgagaagggctgt
gagcctgacaccaccgcaccgtcagggcagaacgagggtgagcgctgtggcactgacctg
gcctacgtttattttgtctccttcatcttcttctgctccttcctgatgctcaacctgttc
gtggctgtcatcatggacaactttgagtaccttactcgagattcctccatcctggggcct
caccacttggatgaatttgtccgtgtctgggcagaatatgacagagcagcatgtggccgc
atccattacactgagatgtatgaaatgctgactctcatgtcaccaccgctaggcctcggc
aagagatgtccctccaaagtggcctataagaggttggtcctgatgaatatgccagtggcc
gaagacatgacagttcacttcacctccacacttatggctctgatccggacggctctggac
attaaaatcgccaaaggtggcgcagacagacaacagctagactcagagctacaaaaagag
accctggccatttggcctcacctgtcccaaaagatgttggatctgctagtgcccatgccc
aaagcctctgacctgactgtgggcaagatctatgcagcaatgatgatcatggactactat
aaacagagtaaggtaaagaaacagagacagcagctggaagaacagaaaaatgcacccatg
ttccagcgcatggagccctcatcactgcctcaggagatcattgctaatgccaaagccctg
ccttatctccagcaggaccctgtttctggcctgagtggtcggagtggatacccttcaatg
agtccactctcccctcaagaaatattccagttggcttgtatggacccagcggatgatgga
cagttccaggaacagcaatctctggagccagaggttagtgaattaaaaagtgtgcagtcc
tctaaccatggcatctaccttcctccggacacccaggagcatgcgggatctgggagggca
tcctctatgccacgtctgactatggatccccaggtggtaacagaccctagctctatgcga
cgttccttttctacaattcgggataagcgttcaaactcctcctggttggaggagttctcc
atggaacgcagcagtgaaaacacttacaagtcacggcgcagaagttaccattcctccctg
aggctgtcggcacaccgcctgaattctgactccggtcacaagtctgacacccaccgatca
ggaggcagggagagaggccgatccaaagaacgaaagcacctcctctctccagacgtctcc
cgctgcaattctgaggagcgagggacccaggctgagtgggagtccccagaacgtcgccag
tccaggtcacccagtgaaggaaggtcacagacccccaacagacagggtactggttcccta
agtgagagttccatcccctctatttccgacaccagcaccccaagacgaagtcgtcgccag
ctcccacctgtgccaccaaagcctcgtcccctcctctcctacagctccctgatgagacac
actggaggcatctctccacctcctgatggaagtgagggtggatccccactggcctctcaa
gctctggagagcaacagcgcttgcctgaccgagtcttccaactccttgcatccgcagcag
ggccagcatccttccccacagcactacatctccgagccctatctggccctccatgaagac
tcccatgcttcagactgtggcgaggaggagacactcacctttgaggcagccgtagccact
agcttgggccggtccaataccattggctctgcaccacccctacggcacagctggcagatg
cctaatgggcactatcggcggcggaggcgtggggggcctgggcctggcatgatgtgtgga
gctgtcagtgacctcctgagtgacacggaagaagatgataagtgctag

DBGET integrated database retrieval system