KEGG   Mus pahari (shrew mouse): 110322900
Entry
110322900         CDS       T05929                                 

Gene name
Tp73
Definition
(RefSeq) tumor protein p73 isoform X1
  KO
K10148  tumor protein p73
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04115  p53 signaling pathway
mpah04390  Hippo signaling pathway
mpah04722  Neurotrophin signaling pathway
mpah05162  Measles
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110322900 (Tp73)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    110322900 (Tp73)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    110322900 (Tp73)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    110322900 (Tp73)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110322900 (Tp73)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    110322900 (Tp73)
SSDB
Motif
Pfam: P53 P53_tetramer SAM_2 SAM_1
Other DBs
NCBI-GeneID: 110322900
NCBI-ProteinID: XP_021055471
Ensembl: MGP_PahariEiJ_G0029215
LinkDB
Position
6
AA seq 643 aa
MSGSVGEMAQSSSSSSSTFEHLWSSLEPDSTYFDLPQPSQGTSEASGSEESNMDVFHLQG
MVSGAMAQFNLLSSAMDQMGSRAAPASPYTPEHAASAPTHSPYAQPSSTFDTMSPAPVIP
SNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIR
AMPVYKKAEHVTDIVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSV
VVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILVIITLETRDGQVLGRRSFEGRICA
CPGRDRKADEDHYREQQALNESTTKNGAASKRAFKQSPPAIPALGTNVKKRRHGDEDMFY
MHVRGRENFEILMKVKESLELMELVPQPLVDSYRQQQQQQLLQRPSHLQPPSYGPVLSPM
NKVHGGVNKLPSVNQLVGQPPPHSSAAGPNLGPMGSGMLNSHSHSMQANGEMNGGHSSQT
MVSGSHCTPPPPYHADPSLVSFLTGLGCPNCIECFTSQGLQSIYHLQNLTIEDLGALKIP
DQYRMTIWRGLQDLKQSHDCGQQLLRSSSNAATISIGGSGELQRQRVMEAVHFRVRHTIT
IPNRGGAGGVTGPDEWADFGFDLPDCKSRKQPIKEEFTETENH
NT seq 1932 nt   +upstreamnt  +downstreamnt
atgagcggcagcgttggggagatggcccagtcctcttcctcctcttcctccaccttcgag
cacctgtggagttctctggagccagacagcacctattttgaccttccccagcccagtcaa
gggactagcgaggcatccggcagcgaggagtccaacatggatgtcttccacttgcaaggc
atggtgagcggggctatggcccagttcaatttgctcagcagtgccatggaccagatgggc
agccgcgcggccccggccagcccctacaccccggagcacgccgccagcgcgcccacccac
tcgccctacgcgcagcccagctccaccttcgacaccatgtctccagcgcctgtcatccct
tccaataccgactaccccggcccccaccacttcgaggtcaccttccagcagtcgagcaca
gccaagtcggccacctggacatactccccacttttgaagaagttgtactgtcagattgcc
aagacatgccccatccagatcaaagtgtccacaccaccacccccgggcacggccatccgg
gccatgcccgtctacaagaaggcagagcacgtgaccgacattgttaagcgctgccccaac
cacgagctcggaagggacttcaatgaaggacagtctgccccggctagccacctcatccgt
gtagaaggcaacaacctctcccagtatgtggatgaccctgtcaccggcaggcagagcgtg
gttgtgccatacgaacccccacaggtgggaacagaattcaccaccatcctgtacaacttc
atgtgtaacagcagctgcgtggggggcatgaatcggaggcccatccttgtcatcatcacc
ctggagacccgggatggacaggtactgggccgccggtctttcgagggtcgcatctgtgcc
tgtcctggccgtgaccgcaaagctgatgaagaccattaccgggagcaacaggctctgaat
gaaagtaccaccaagaatggggctgccagcaaacgtgcattcaagcagagcccccctgcc
atccccgccctgggtaccaacgtgaaaaagagacgccacggggacgaggacatgttctac
atgcacgtgcgaggccgggagaactttgagatcttgatgaaagtcaaggagagcctagag
ctgatggagcttgtaccccagcctttggtcgactcctatcgacagcagcagcagcagcag
ctcctacagaggccgagtcacctgcagcctccctcctatgggcctgtgctctccccaatg
aacaaggtacacggtggtgtcaacaaactgccctctgtgaaccagctggtgggccagcct
cccccgcacagctcagcagctgggcccaacctgggccccatgggttccgggatgctcaac
agccacagccacagcatgcaggccaatggtgagatgaatggaggccacagctcccagacc
atggtttcgggatcccactgcaccccaccacccccctatcatgcagaccccagcctcgtc
agttttttgacagggttggggtgtccaaactgcatcgagtgcttcacttcccaagggttg
cagagcatctaccacctgcagaacctcaccatcgaggaccttggggctctgaagatccct
gaccagtaccgtatgaccatctggaggggcctacaggacctgaagcagagccatgactgc
ggccagcaattgctacgctccagcagcaacgcggccaccatctccatcggcggctctggc
gagctgcagcggcagcgggtcatggaagccgtgcatttccgtgtgcgccacaccatcacg
atccccaaccgtggaggcgcaggtggggtgacaggccccgacgagtgggcggactttggc
tttgacctgcctgactgcaagtcccgtaagcagcccatcaaagaggagttcacagagaca
gagaaccactga

DBGET integrated database retrieval system