KEGG   Mus pahari (shrew mouse): 110329713
Entry
110329713         CDS       T05929                                 

Gene name
Runx1
Definition
(RefSeq) runt-related transcription factor 1 isoform X1
  KO
K08367  runt-related transcription factor 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04530  Tight junction
mpah04659  Th17 cell differentiation
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05220  Chronic myeloid leukemia
mpah05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110329713 (Runx1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    110329713 (Runx1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110329713 (Runx1)
   05202 Transcriptional misregulation in cancer
    110329713 (Runx1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    110329713 (Runx1)
   05220 Chronic myeloid leukemia
    110329713 (Runx1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110329713 (Runx1)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Runt
    110329713 (Runx1)
SSDB
Motif
Pfam: Runt RunxI DUF3037
Other DBs
NCBI-GeneID: 110329713
NCBI-ProteinID: XP_021065172
Ensembl: MGP_PahariEiJ_G0016683
LinkDB
Position
12
AA seq 466 aa
MMASDSIFESFPSYPQCFMRDASTSRRFTPPSTALSPGKMSEALPLGAPDGGAALASKLR
SGDRSMVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTV
MAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRA
IKITVDGPREPRRHRQKLDDQTKAGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRAS
LNHSTAFNPQPQSQMQDARQIQPSPPWSYDQSYQYLGSITSSSVHPATPISPGRASGMTS
LSAELSSRLSTAPDLTAFGDPRQFSTLPSISDPRMHYPGAFTYSPPVTSGIGIGMSAMSS
ASRYHTYLPPPYPGSSQAQAGPFQTGSPSYHLYYGASAGSYQFSMVGGERSPPRILPPCT
NASTGAALLNPSLPSQSDVVETEGSHSNSPTNMPPARLEEAVWRPY
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgatggcttcagacagcatttttgagtcatttccttcatatccacaatgcttcatgaga
gatgccagcacgagccgccgcttcacgccgccttccaccgcgctgagccccggcaagatg
agcgaggcgctgccgctgggcgccccggatggcggcgccgccctggccagcaagctgagg
agcggcgaccgcagcatggtggaggtactagctgaccaccccggcgagctagtgcgcacc
gacagccccaacttcctctgctccgtgctgcccactcactggcgctgcaacaagaccctg
cccatcgctttcaaggtggtggcactgggggacgtcccagatggcactcttgtcaccgtc
atggcaggcaacgatgaaaactactcggcagagctgagaaatgctaccgcggccatgaag
aaccaggtggcaagattcaacgacctcaggtttgtcgggcggagtggtagaggcaagagc
ttcactctgaccatcaccgtctttacaaacccgccacaagttgccacctaccacagagcc
atcaaaatcacagtggacggcccccgagaaccccgaagacatcggcagaaactagatgat
cagaccaaggccgggagtttgtccttttccgagcggctcagtgaactggagcagctgcgg
cgcacggccatgagggtcagcccgcaccacccagcccccacgcccaaccctcgggcctcc
ttgaaccactccactgcctttaaccctcagcctcaaagtcagatgcaggatgccaggcag
atccagccgtccccaccatggtcctatgaccagtcctaccagtacctgggatccatcacc
tcttcctctgtgcacccagcgacacccatttcacccggccgtgccagcggcatgaccagc
ctctctgcagaactttccagtcgactctcaacggctccggacctgacagcctttggcgac
ccgcgccagttctctacgctgccgtccatctctgacccgcgcatgcactacccaggcgcc
ttcacctactcgccgcccgtcacgtcgggcattggcatcggcatgtcagccatgagctcg
gcctctcgctaccacacctacctgccaccgccctaccccggctcctcgcaggcgcaggcc
gggcccttccagaccggctcgccctcctaccatctatactacggcgcctcggccggctcc
taccagttctccatggtgggcggcgagcgatcgcctccgcgcatcctgccgccctgcacc
aacgcatccaccggcgccgcgctgctcaaccccagcctccccagccagagcgacgtggtg
gagaccgagggcagccatagcaactcgcccaccaacatgccccccgcgcgcctggaggag
gccgtgtggcggccctactga

DBGET integrated database retrieval system