KEGG   Microbacterium paludicola: BO218_01640Help
Entry
BO218_01640       CDS       T04601                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
mpal  Microbacterium paludicola
Pathway
mpal00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:mpal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    BO218_01640
Enzymes [BR:mpal01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BO218_01640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_14 Glyco_hydro_35 Glyco_hydro_2_C DUF4434 Cellulase DUF4350 Dehydratase_hem Nre_C
Motif
Other DBs
NCBI-ProteinID: APF33059
LinkDB All DBs
Position
complement(341861..343882)
Genome map
AA seq 673 aa AA seqDB search
MPASVWPAIDGIAYGGDYNPEQWPREVWREDVRLMREAGVNLVSVGIFSWALIETSAGVF
DFDWLDEIIGLLHENGIAVDLGTPTASPPAWFFAEHPDARAVNRDGVVMGFGSRGMASHS
APAYREAAIRIASTLAERYADHPAVVMWHVHNEYGVPVGEDYSPHAQRAWRTWLQEKYGS
LDALNAAWGTAFWGQHYGVWEHVGVPAAAPSVVNPAQRLDFARFTDAQLRACFVAERDAI
RRFSSLPVTTNFMANQHHGCDLWAWAREVDIVSDDHYLWAADVEGEIGLAIAADLSRSVG
GGKPWILMEHSTSAVNWQPRNIAKRPGEMARNSLSHLGRGADGILFFQWRAGRSGAEKFH
SAMLPHAGTESRVFREVVDLGAKLNRLAEVRGSRVHADVAILWDFESFWAQDLEWRPSED
VSHDERIRAFYERLWRDNITVDFALPGHDLSGYQLVIAPAQYLLRQADADNLNRYVEAGG
TLVVSFFSGVVDENDAVHPGGFAAPLEPALGIRVEEHLPLRAGVTTTIDVGGASHTADIW
HEHLVVSEAEVRATYVDGPGAGMPAVTRKRHGAGTGWYVSTRPDAAGLAAIMAEVYADAG
VAPLDAPAGLEIVRRTGDADDYVIAINHAATDAELALEGVDLVTGRAARGTLEVSAGDVA
VIRTPRTAHGSGR
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcgagcgtttggccggccatcgacgggatcgcctacggcggcgactacaacccg
gagcagtggccccgcgaggtctggcgcgaggacgtccgcctcatgcgcgaggccggggtg
aacctggtcagcgtcggcatcttctcgtgggcgctcatcgagaccagcgcaggcgtattc
gacttcgactggctcgacgagatcatcggcctgctccacgagaacggcatcgccgtcgac
ctcggcacccccacggcatccccgcccgcctggttcttcgccgagcaccccgatgcgcgt
gcggtcaaccgcgacggcgtggtgatgggcttcggctcgcgcggcatggcgtcgcactcc
gcacccgcttaccgtgaggccgccatccgcatcgcctcgacgctcgccgagcggtacgcc
gaccacccggccgtcgtcatgtggcacgtgcacaacgagtacggcgttcccgtcggcgag
gactactccccccacgcgcagcgagcctggcgcacctggctgcaggagaagtacggctcg
ctcgacgcgctcaacgcggcgtggggcaccgcgttctggggccagcactacggcgtgtgg
gagcacgtgggcgtcccggccgcagcgccgtcggtcgtgaacccggcgcagcggctcgac
ttcgcccggttcaccgacgctcagctgcgcgcgtgcttcgtcgccgagcgcgacgccatc
cggcgcttctcgtctctcccggtcacgacgaacttcatggccaaccagcaccacggctgc
gacctctgggcctgggcgcgcgaggtcgacatcgtctcggacgaccactacctgtgggcc
gccgacgtcgagggcgagatcggtctggccatcgccgcggacctctcccgctcggtcggg
ggcggcaagccctggatcctcatggagcactcgacctcggcggtcaactggcagccgcgg
aacatcgccaagcgcccgggcgagatggcgcgcaactcgctgtcgcacctcggacgcggc
gcagacggcatcctcttcttccagtggcgggccggacggtcgggcgccgagaagttccac
tcggcgatgctcccgcacgccggcaccgagtcgcgggtgttccgcgaggtggtcgatctc
ggcgcgaagctgaaccggctcgccgaggtgcgcggctcgcgcgtgcacgccgacgtcgcg
atcctgtgggacttcgagtcgttctgggcgcaggatctggaatggcgcccgtcggaggac
gtgtcgcacgacgagcgcatccgcgcgttctacgagcgcctgtggcgcgacaacatcacg
gtcgacttcgccctgccgggtcacgacctgtcgggctaccagctcgtcatcgcgcccgcg
cagtaccttctgcgccaggccgacgccgacaacctcaaccggtatgtcgaagccggcggc
acgctggtcgtctcgttcttctcgggcgtcgtcgacgagaacgacgccgtgcacccgggg
ggcttcgccgctccgctcgagccggcgctcggcatccgcgtcgaagagcacctgccgctg
cgcgccggagtgaccacgacgatcgatgtcggcggcgcgtcgcacaccgccgacatctgg
cacgagcacctcgtcgtctccgaggcggaggtccgcgcgacctatgtcgacggaccgggc
gcggggatgcccgcagtgacgcgcaagcggcacggcgccggcaccggctggtacgtgagc
acgcgaccggatgccgcgggcctcgcggccatcatggccgaggtgtacgccgacgcgggc
gtcgccccgctcgacgcgccggccggcctcgagatcgtccgccgtaccggcgacgccgac
gactacgtcatcgcgatcaaccacgcggcgacggacgctgagctcgccctggagggcgtc
gacctggtgacaggtcgcgccgcccggggcacgctggaggtgagtgcgggcgacgtcgcc
gtcatccgcactccgcgcacagcacacgggagcggccgatga

DBGET integrated database retrieval system