KEGG   Microbacterium paludicola: BO218_04155Help
Entry
BO218_04155       CDS       T04601                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mpal  Microbacterium paludicola
Pathway
mpal03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mpal00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    BO218_04155
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mpal03400]
    BO218_04155
Enzymes [BR:mpal01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BO218_04155
DNA repair and recombination proteins [BR:mpal03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BO218_04155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M LigD_N DNA_ligase_A_C RNA_ligase DNA_primase_S DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: APF33491
LinkDB All DBs
Position
864379..866844
Genome map
AA seq 821 aa AA seqDB search
MAGEQTVRVDGRRLRLSNLDKVLYPRTGTTKGEVIDYFSRIAPLMLPHLDRRPVTRKRWP
EGVEQPDFFAKALEPGAPSWLPRMPIDHSSGSKDYPLVEEVASLVYLAQVASLELHVPQW
RFTDAGERGSPDRLVLDLDPGPGVGLAECAEVARWVRSILSDMGMELFPVTSGSKGIHLY
APLAGAKTSDQASAFAKELARALEADHPDLVISQMTRSARTGKVFLDWSQNNGSKTTIAP
YSLRGRDEPTVAAPRTWDELDDPDLRHLRFDEMLERADEVGDLLAALAPRRTAPLAPYLA
KRSADRTPEPMPDAVSGAAAGVAGTAPAGKPRFVVQEHHARRLHYDLRLERDGVLVSWAV
PRGIPETTDRNHLAVMTEPHPLEYLTFHGEIPAGEYGAGTMTIWDTGVYDLEKWREDEII
FTLRGTTGGTAHDARLVLIRTGGSGEKSQWLLHRMKTEAPGSAPSAPAGSARPAASARPP
ASAHSDAETGASTIAAGPVSPMLAVSSSRGAARATAERWGPWVEFKWDGVRAIAYWDGER
MRLHARSGTDITARYPELTGEDADLGLGETPLVLDGEIVALDGAGRPSFPLLQNRMHLTK
ARDIARERDRTPADLFVFDMLRHGDRDVTTLPLRERRRLLESATAHAKPPLTVPPVTDDL
DAALTVARELDLEGAVVKDPSSRYRPGARSEEWLKVKLTRTQDVVVGAIRPGKGERRGGI
GSLLLGIPDDDGALHYAGRVGSGFSDAELARLTAALEPLRSKENPFVGIPAADASDARWV
RPELVGEVEFAEFTPGGILRHARWRGLRPDRTPGGVRREES
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atggcaggagagcagacggtccgggtcgacggccgacgtctgcggctgtcgaacctcgac
aaggtgctgtaccccagaacgggcaccaccaagggcgaggtgatcgactacttctcgcgc
atcgcgcccctgatgctcccccacctcgaccggcgcccggtgacgcgcaaacgctggccc
gagggcgtcgaacagcccgatttcttcgcgaaagccctcgagcccggcgctccctcatgg
ctcccccgcatgccgatcgaccattccagcggatcgaaggactaccccctcgtcgaagag
gtggcctcgctcgtctacctcgcgcaggtcgcgagcctcgaactgcacgtcccgcagtgg
cgcttcaccgacgccggcgagcgcggctctcccgaccggctcgtcctcgacctcgatccg
ggccccggtgtcgggctggccgagtgcgccgaggtggcgcggtgggtgcgcagcatcctc
tcggacatgggaatggagttgtttcccgtcacgagcggaagcaagggcatccatctgtac
gctccgctcgccggcgcgaagacgagcgatcaggcctcggcgttcgcgaaagagctcgcc
cgcgctctcgaggccgatcaccccgacctcgtcatcagtcagatgacccggagcgcccgc
accggcaaggtcttcctcgactggagccagaacaacggttcgaagaccaccatcgcgccc
tattcgctgcgcggccgcgatgagccgaccgtcgctgcaccgcgaacgtgggacgagctc
gacgatccggacctccgccacctccgcttcgacgagatgctcgagcgcgcagacgaagtc
ggcgacctgctcgcggcgctcgcaccccggcgaacggcaccgctggcgccgtacctcgcg
aagcggtccgcggaccgcacgcccgagcccatgcccgatgccgtgtcgggtgcggcggcg
ggcgttgcgggtaccgcaccagcgggcaagccccgcttcgtcgtgcaggagcaccatgcc
cggcggctgcactacgacctgcgcctggagcgggacggagtgctggtcagctgggccgtg
ccccgcggcatccccgagacgaccgaccgcaaccatctcgccgtgatgaccgagccgcat
ccgctggagtatctgaccttccacggcgagatccccgccggtgagtacggtgcgggcacc
atgacgatctgggacaccggcgtctacgacctcgagaagtggcgcgaggacgagatcatc
ttcaccctccggggcaccaccggcggaaccgcgcacgacgcgcgcctcgtgctcatccgc
accggcgggtcgggcgagaagtcgcagtggctcctgcaccggatgaagaccgaggctccg
gggtcggccccctccgcacccgcggggtctgcgcggccggcggcatccgcgcggccgccg
gcatctgctcattccgacgccgagacgggcgcatcgacgatcgcggcgggaccggtgtcg
cccatgctggccgtctcatcgtcgcgcggagccgcccgcgcgacggcggaacgctggggg
ccgtgggtcgagttcaagtgggatggcgtccgggcgatcgcgtactgggacggcgagcga
atgcggttgcacgcccgcagcggcaccgacatcacggcccgctaccccgagctcacgggc
gaggacgcggatctgggactcggcgagacccccctggtgctcgacggcgagatcgtcgcg
ctcgacggggcgggacgcccgagcttcccgctcctgcagaaccggatgcacctcacgaag
gcccgcgacatcgcgcgggagcgcgaccgcacgcccgccgatctcttcgtgtttgacatg
ctgcggcacggcgaccgcgacgtcacgaccctgccgttgcgcgagcgccgacgactgctc
gagtccgcgacggcgcacgcaaaaccgccgctcacggtgccgcccgtcaccgacgacctc
gacgccgcgctgaccgtggctcgggagctcgatctcgagggtgccgtcgtgaaggacccg
tcatcccgttaccgccccggcgctcgatcggaggaatggctcaaggtcaagctcacccgc
acgcaggacgtcgtcgtcggcgcgatccggccgggcaagggcgagcggcgcgggggcatc
gggtcgctgctgctcggcattcccgacgacgacggcgctctgcactacgccgggcgcgtc
ggatccgggttctccgatgccgaactcgcgcggctgaccgccgccctcgagcctctccgc
tcgaaagagaacccgttcgtgggcatccccgcagccgacgcctccgacgcccggtgggtt
cgacccgagctcgtcggcgaggtcgagttcgccgagttcacgccgggcggcatcctgcgc
cacgctcgctggcggggcctgcggccggaccggacccccggcggcgtccgccgagaagag
agctag

DBGET integrated database retrieval system