KEGG   Mycolicibacterium phlei: MPHLCCUG_03022Help
Entry
MPHLCCUG_03022    CDS       T04305                                 

Gene name
puuE_1
Definition
(GenBank) 4-aminobutyrate aminotransferase PuuE
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
mphl  Mycolicibacterium phlei
Pathway
mphl00250  Alanine, aspartate and glutamate metabolism
mphl00280  Valine, leucine and isoleucine degradation
mphl00310  Lysine degradation
mphl00410  beta-Alanine metabolism
mphl00640  Propanoate metabolism
mphl00650  Butanoate metabolism
mphl01100  Metabolic pathways
mphl01120  Microbial metabolism in diverse environments
Module
mphl_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mphl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MPHLCCUG_03022 (puuE_1)
   00650 Butanoate metabolism
    MPHLCCUG_03022 (puuE_1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MPHLCCUG_03022 (puuE_1)
   00280 Valine, leucine and isoleucine degradation
    MPHLCCUG_03022 (puuE_1)
   00310 Lysine degradation
    MPHLCCUG_03022 (puuE_1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MPHLCCUG_03022 (puuE_1)
Enzymes [BR:mphl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     MPHLCCUG_03022 (puuE_1)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     MPHLCCUG_03022 (puuE_1)
    2.6.1.48  5-aminovalerate transaminase
     MPHLCCUG_03022 (puuE_1)
Amino acid related enzymes [BR:mphl01007]
 Aminotransferase (transaminase)
  Class III
   MPHLCCUG_03022 (puuE_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AMO61831
LinkDB All DBs
Position
3086692..3088044
Genome map
AA seq 450 aa AA seqDB search
MTSTTSTLEQSRLLTTSIPGPRSQELAARKNSAVARGVGTTMPVYAAHAFGGIVEDVDGN
RLIDLGSGIAVTTIGNSSPRVVDAVRAQVAEFTHTCFMITPYEGYVAVAEHLNRLTPGSG
EKRTALFNSGAEAVENAIKIARAYTHKPAVVSFDHAYHGRTNLTMALTAKSMPYKHGFGP
FAPEVYRAPLSYPFRDAEFGKEFATDGERAAQRAISVIDKQVGADNLAAVIIEPIQGEGG
FIVPADGFLPALRNWCRDNGVVFIADEVQTGFARTGRMFACEHEGLEPDLIITAKGIADG
MPLSAVTGRAEIMDAPHVSGLGGTYGGNPVACAAALATIETIESDGLVERARQIETLMKD
RLNRLQASDDRIGDVRGRGAMIAIELVKPGTLEPDAELTKALCAGCHAAGVIVLSCGTYG
NVVRFLPPLTISDELLIEGLDVLELVLKDL
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
gtgacgagcacgacgagcacccttgagcagagccgactgctcaccacctctattcccggc
ccgcgatcgcaggagctggccgcccgcaagaactcggccgtcgcccgcggcgtcggcacc
acgatgccggtctacgcggcgcacgcgttcggcggcatcgtcgaggacgtcgacggtaac
cggctgatcgacctcggatcgggcatcgcggtcaccacgatcggcaactcctcgccgcgc
gtcgtcgacgcggtgcgcgcgcaggtcgccgagttcacccacacctgcttcatgatcacg
ccctacgaggggtacgtggcggtcgccgaacacctcaaccggctcaccccgggcagcggc
gagaaacgcaccgcgctgttcaactccggcgccgaggcggtggagaacgcgatcaagatc
gcccgggcgtacacccacaagcccgcggtggtgtcgttcgaccacgcctaccacggccgg
accaacctgacgatggcgctgaccgccaagtcgatgccctacaagcacggcttcggcccg
ttcgccccggaggtctaccgcgccccactgtcctacccgttccgggatgcggagttcggc
aaggagttcgccaccgacggtgagcgggccgcgcagcgggcgatcagcgtgatcgacaaa
caggtcggcgcggacaacctggccgcggtgatcatcgagccgatccagggcgagggcggc
ttcatcgtgcctgccgacggcttcctgcccgcactgcgaaactggtgccgtgacaacggc
gtggtgttcatcgccgacgaggtgcagaccgggttcgcgcgcaccggcaggatgttcgcc
tgcgagcacgagggtctggaacccgacctgatcatcaccgccaagggcatcgccgacggg
atgccgctgtctgcggtcaccggccgcgccgagatcatggacgccccgcatgtcagcggt
ctcggcggcacgtacggcggcaacccggtggcctgcgcggcggcgctggccacgatcgag
accatcgagtccgacggtctggtggagcgggcccggcagatcgagacgctgatgaaggac
cggctcaaccggctgcaggcctccgacgaccgcatcggtgacgtgcgcggccgcggcgcg
atgatcgccatcgaactggtcaagcccggcaccctcgaacccgacgccgagctgaccaag
gcgctgtgcgcgggctgccatgccgcgggcgtgatcgtgttgtcctgcggcacgtacgga
aatgtggtccgctttcttccgcccctgacgatcagcgacgagctgctcatcgagggcctc
gacgtactcgaactcgtcctcaaagacctgtga

DBGET integrated database retrieval system