KEGG   Microcystis panniformis: VL20_5586Help
Entry
VL20_5586         CDS       T04037                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mpk  Microcystis panniformis
Pathway
mpk00620  Pyruvate metabolism
mpk00680  Methane metabolism
mpk00710  Carbon fixation in photosynthetic organisms
mpk01100  Metabolic pathways
mpk01120  Microbial metabolism in diverse environments
mpk01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mpk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VL20_5586
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    VL20_5586
   00680 Methane metabolism
    VL20_5586
Enzymes [BR:mpk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     VL20_5586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AKV70408
UniProt: A0A0K1S8Q1
LinkDB All DBs
Position
complement(4915889..4918945)
Genome map
AA seq 1018 aa AA seqDB search
MSVLVPSTETEQDIFSTSNLFLQQRLKLIEDLWKEVLVSECGQELVDLLELLRHLCSEEG
QVTDDSPEAMIAKMIEDLELGEAIKVTRAFALYFQLINIIEQHYEQRDQQLLRRTVIGEE
NESPKTDPPQKSLLATIVGADWLEKTLNESDHSGPKSGLFHWLFPYLKQVNVPPQEIQRL
LDQLDIRLVFTAHPTEIVRHTIRIKQRRISGILEKLDQAEEIFRSMGLTNSREAQTVTKQ
LKEEIRFWWRTDELHQFKPTVVDEVDYALHYFDEVLFDSLPQLTLRLQQSLQSSFPRLQA
PKNNFCRFGSWVGGDRDGNPSVTPEVTWKTCCYQRNLVIKKYLDAIRDLTSILSASLHWC
HVLPELLDSLDRDKQQMPEIYSQLAIRYRQEPYRLKLAFIQKRLENTRDRNNRLNDPEER
QLLTKLNETNIYRSGSEFLAELQLLQRSLLQTGLSCQELDRLIAQVEIFGFVLTQLDFRQ
ESTRHAECIEEIAAYLGVLPKPYGQLTESEKIAWLVAELKTRRPLIPREMPFSERTCETI
ETLRVLRSLQGEFGLEICQTYIISMTNEASDVLEVLLLAQEAGLYDPATSRSSLRIVPLF
ETVDDLKHAPGIMQTLFELPLYRAALAGGYDHLGALNGEEVTPEPAILEPGNLQEIMVGY
SDSNKDSGFLSSNWEIHKAQKALQKTAKQYGLDLRLFHGRGGSVGRGGGPAYAAILAQPR
GTINGRIKITEQGEVLASKYSLPELALYNLETAVTAVIQASLLGSGFDDLEPWNRIMEEL
ATRSRQTYRSLIYEEPDFLDFFLSVTPIPEISLLQISSRPARRKSGQQDLSTLRAIPWVF
SWTQTRFLLPAWYGLGTALQMFLDDSPNRNLELLRHFYHKWPFFQMVISKAEMTLSKVDL
QIAYHYVSELSKQEDRERFQRLFERIKEEYNRTSEIVLQITGEKNLLDNDPNLQRSVQLR
NGSIVPLGFLQVSLLKRLRQYNSQAQSGVIHFRYSKEELLRGALMTINGIAAGMRNTG
NT seq 3057 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtccttgtcccctcaaccgaaaccgaacaggatattttcagcacttccaacctg
tttctgcagcaaagactgaaattaatcgaagatttatggaaagaagtcttagtctccgaa
tgtggtcaagaattagtcgatttactggaattactgcgccatctctgttctgaggaagga
caagtgaccgatgatagtccggaagcaatgatcgccaaaatgatcgaagacttggaacta
ggggaagcgatcaaagttacccgcgcttttgccctctatttccagttaataaatataatc
gaacaacactacgaacaaagggatcagcaactactgcgacggacggtgatcggggaagaa
aacgaaagtcccaagacagacccaccgcaaaaaagccttttagccaccattgtcggggct
gattggctagaaaaaaccctgaacgagtccgatcactccggcccaaaatcgggactattt
cactggttatttccctatctcaaacaggtgaacgtccccccccaggaaatccagcgtctt
ctcgatcaattagatattcgtctggttttcacagcccaccccacggaaattgtccgtcat
accattcgcattaaacagcgccgcatctcgggcattctcgaaaaactcgaccaagcagaa
gaaatctttcgcagtatggggttaactaactccagagaagcacaaacagtcaccaaacag
ttaaaagaagaaattcgtttttggtggcgaacagatgaactacatcaatttaaacccacc
gtcgtcgatgaggtggattatgccctgcactacttcgatgaagttctcttcgattcccta
ccccagttaaccctgcgtctgcagcaaagcctacaatcctcctttccccgtttacaagcg
ccgaaaaataacttctgtcgcttcggttcttgggtggggggggatcgggatggcaatccc
tccgttacccccgaagtcacctggaaaacctgctgttatcagcgcaatctcgttattaaa
aaatatctcgatgctattcgcgacctgaccagtattttaagtgcctccctgcactggtgt
cacgtcttgccggagttgctggactccctggacagagataagcagcaaatgcccgaaatc
tatagccagttagcaatccgctaccgtcaggaaccctatcgcctcaaattggcctttatt
caaaaacgtctggaaaatacacgcgatcgcaataatcgcctcaatgatccggaagaacga
cagttattaactaaactcaacgaaaccaacatctatcgctctggttccgagtttttagcc
gaattacagctattacagcgcagtctcttgcaaaccggtctttcctgtcaagaactcgat
cgactgatcgcccaagtggagatttttggctttgtcctgactcagttagattttcggcaa
gaatccacccgtcacgccgaatgtatcgaagaaatcgccgcctatctcggagttttaccc
aaaccctacggccaattaaccgaatcagaaaaaatcgcctggttagtggcggaattaaaa
acccgtcgccccttaattccccgggaaatgcccttctcggaaagaacctgcgaaaccatt
gaaaccctgcgagttttaagaagtctgcaaggggaattcggtctggaaatctgccaaacc
tacattatcagcatgaccaacgaggccagcgatgtgctagaagtgctgttattagcccaa
gaagccggtttatacgaccctgccactagccgcagttccctccgcattgttcccctcttt
gaaaccgtcgatgacctcaaacacgcccccggcatcatgcagactttgtttgaattgccc
ctctaccgggcagccctagccggcggttacgaccatttaggggctttaaacggggaggaa
gtgaccccggaaccggccatcctcgaaccgggtaatttacaggagattatggtgggttac
tccgatagtaataaggattccggctttttaagcagtaattgggaaattcataaggcccag
aaggctttacaaaaaaccgctaaacaatacggcttggatctacgtctttttcatggccgg
ggcggttccgtcggtcggggtggtggacctgcctacgccgctatcctcgcccaaccccgg
ggaacgattaacggtcgcattaaaatcaccgaacaaggcgaggttttagcctcgaaatac
tctttaccagaattggccttgtataacctcgaaacggccgtaacggcagtcatacaggca
agtttactgggcagtggttttgatgatctcgaaccctggaatcgcatcatggaggagttg
gccacccgttcacggcaaacctatcgcagtttgatttatgaagaaccggactttttagac
ttctttctgtccgtaactcccattcctgaaattagtcttttacagattagttcccgaccg
gcgcgccggaaaagtggtcaacaggatttaagtaccctgcgggcaattccctgggtattt
agttggactcaaacccgttttcttttaccagcttggtatggtttagggacagctttgcag
atgtttctcgatgattctcctaaccgaaatttagaattgttgcgccatttttatcacaag
tggcccttcttccagatggtgatttctaaagcagaaatgactctatcgaaggtggatcta
cagattgcctatcactacgtcagtgaactttctaaacaggaagatcgagaacgttttcaa
cgtctgtttgaaaggatcaaagaggaatataatcgcactagcgagattgttctccagatc
accggcgagaaaaatttattagataatgatccgaatttacagcgctcggtgcagttacgc
aacggttcgatcgttcccctcggtttcctacaggtgtctctcctcaagcgtttacgtcaa
tacaatagtcaagctcaatccggtgtgattcatttccgctattctaaagaggagttatta
aggggcgctttaatgacgattaatggtattgccgcagggatgagaaataccggttga

DBGET integrated database retrieval system