Moniliophthora perniciosa: MPER_00906 Help Entry MPER_00906        CDS       T01089                                  Name (GenBank) hypothetical protein   KO K03537   ribonuclease P/MRP protein subunit POP5 [EC:3.1.26.5] Organism mpr  Moniliophthora perniciosa Pathway mpr03008   Ribosome biogenesis in eukaryotes Brite KEGG Orthology (KO) [BR:mpr00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     MPER_00906  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:mpr03009]     MPER_00906    03016 Transfer RNA biogenesis [BR:mpr03016]     MPER_00906    03029 Mitochondrial biogenesis [BR:mpr03029]     MPER_00906 Enzymes [BR:mpr01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.26  Endoribonucleases producing 5'-phosphomonoesters     3.1.26.5  ribonuclease P      MPER_00906 Ribosome biogenesis [BR:mpr03009]  Eukaryotic type   Pre-60S particles    RNases     RNase MRP      MPER_00906 Transfer RNA biogenesis [BR:mpr03016]  Eukaryotic type   5'processing factors    Ribonucrease P     MPER_00906 Mitochondrial biogenesis [BR:mpr03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial transcription and translation factors    RNase MRP     MPER_00906 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNase_P_Rpp14 Motif Other DBs NCBI-ProteinID:  EEB99422 UniProt:  E2L579 LinkDB All DBs AA seq 59 aa AA seqDB search MVRFKNRWLLIEFLPLDQLSNSTQTLSHIEGKHIWGAIKQSVITHFGDVGWGCVGLSLT NT seq 178 nt NT seq  +upstreamnt  +downstreamnt atggttcgattcaagaaccgctggctcttaatcgaatttcttcctctcgaccaattatcc aattcaacgcaaacactatcgcacatcgagggtaaacatatctggggggcgataaagcag agtgttataactcattttggggatgtcgggtggggatgtgttgggctgtcgttgactg

DBGET integrated database retrieval system