Moniliophthora perniciosa: MPER_07752 Help Entry MPER_07752        CDS       T01089                                  Name (GenBank) hypothetical protein   KO K11254   histone H4 Organism mpr  Moniliophthora perniciosa Brite KEGG Orthology (KO) [BR:mpr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mpr03036]     MPER_07752 Chromosome and associated proteins [BR:mpr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     MPER_07752 BRITE hierarchy SSDB OrthologParalogGFIT Other DBs NCBI-ProteinID:  EEB93568 UniProt:  E2LLY3 LinkDB All DBs AA seq 79 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK IFLENVIRDSVTYTEHAKR NT seq 236 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgtggaaaaggtggaaagggtctcggaaagggaggtgccaagcgtcatcgt aaaatccttcgtgacaacatccagggtattaccaagcccgctattcgtcgtctcgcccgt cgtggtggcgtcaagcgtatttctggccttatttacgaagagacccgtggagttttgaag atcttccttgagaatgttattcgtgactctgttacttacactgagcacgccaagcg

DBGET integrated database retrieval system