KEGG   Methylibium petroleiphilum: Mpe_A2381
Entry
Mpe_A2381         CDS       T00470                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mpt  Methylibium petroleiphilum
SSDB
Motif
Pfam: DUF4400
Other DBs
NCBI-ProteinID: ABM95336
UniProt: A2SIE7
LinkDB
Position
2547058..2547807
AA seq 249 aa
MSDPAVAAQRQQQRQQGLIASLVTLPFRFFGVLCGALLLCILIECVGMHFFWPEQGWRHA
QGMLHYELDQLSTHFTRSALVQEPGRTAHRLVEQGYDWLFVKSGLLDWIRDASAQASAGS
HRPTKDFRYYIGLVYVNVESYLIAAAYTTLVFLVRLLVLCLTLPLFLMAAFVGLVDGLVR
RDIRRFGAGRESGFIYHRARASLIPLAVLPWVTYLALPVSVNPLLILLPSAALLGVAVCI
AAATFKKYL
NT seq 750 nt   +upstreamnt  +downstreamnt
atgagcgatccggccgtcgcggcacagcgccagcagcaacgacagcaaggcctgatcgcc
agcctggtcacgctgccgttccgcttcttcggcgtgctgtgcggcgcgctgctgctgtgc
atcctgatcgaatgcgtcggcatgcacttcttctggcccgagcagggctggcgccacgcg
cagggcatgctgcactacgagctggatcagctttccacgcatttcacccgcagcgcgctg
gtgcaggagccggggcgcaccgcgcaccggctggtcgagcagggctacgactggctgttc
gtgaagagcggtctgctggactggatacgcgacgcctcggcgcaggccagcgccggcagc
catcgtccgaccaaggatttccgctactacatcggcttggtctatgtgaacgtggagagc
tacctgatcgcggcggcctatacgacgctggtcttcctcgtgcggctgctggtgctgtgc
ctgaccctgccgctgttcctgatggccgccttcgtcgggctggtcgacggcctggtgcgc
cgggacatccgccgcttcggcgcgggacgcgagtcggggttcatctatcaccgcgccagg
gccagcttgatcccgctggccgtactaccgtgggtgacttacctggcactgccggtcagc
gtgaacccgctgctgatcctgctgcccagcgctgcattgctcggcgtggcggtgtgcatt
gcggcggcgacgttcaagaagtatctctaa

DBGET integrated database retrieval system