KEGG   Marichromatium purpuratum: MARPU_15615Help
Entry
MARPU_15615       CDS       T03650                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mpur  Marichromatium purpuratum
Pathway
mpur00250  Alanine, aspartate and glutamate metabolism
mpur00410  beta-Alanine metabolism
mpur00430  Taurine and hypotaurine metabolism
mpur00650  Butanoate metabolism
mpur01100  Metabolic pathways
mpur01110  Biosynthesis of secondary metabolites
mpur01120  Microbial metabolism in diverse environments
mpur02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mpur00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    MARPU_15615
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MARPU_15615
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MARPU_15615
   00430 Taurine and hypotaurine metabolism
    MARPU_15615
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    MARPU_15615
Enzymes [BR:mpur01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     MARPU_15615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AHF05109
UniProt: W0E7B2
LinkDB All DBs
Position
3525756..3527144
Genome map
AA seq 462 aa AA seqDB search
MVTRKIESISPEEQDALLAPAYARRRMLEGVPRYRLPEHEMAPETAHDLIHDELMLDGNA
RLNLATFVTTWMEPQAERLMAEAFDKNLIDKDEYPRTAEIEARCVNIVSDLFHAPEQGVG
ASAIGSSEAVMLAGMALKWRWRARRRARGEDTHRPNLILGANVQVVWEKFCRYWDVEPRY
IPMEKGRYVITPEEVIARTDAHTIGVVAILGTTFTGEYEPIEAIHAALEAQNATTGWEIP
MHVDAASGGFVAPFLDPELVWDFRLPLVKSINVSGHKYGLVYPGVGWVVWRSHEDLPEEL
IFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGRAGYTQVMTALREVATGLARGVAD
LGPFELVSDASTIPVFAFKLRDEITDYSVFDISHKLRESGWQVPAYTMPEHAESVAVLRV
VVREGFSADLAELLLADLAKAVAHFEGLRAHDPAPPTPSFAH
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggtgacgcgaaagatcgagtcgatcagccccgaggagcaggatgcactgctcgcgccg
gcctatgcacgacggcggatgctggagggggtaccgcgataccgtctgccggagcacgag
atggcccccgagacggcccatgacctgatccacgacgagctgatgctcgacggcaacgcc
cggctcaacctggccaccttcgtcaccacctggatggagccccaggccgagcggctgatg
gccgaggccttcgacaagaacctgatcgacaaggacgagtacccgcgcaccgccgagatc
gaggcgcgctgcgtcaacatcgtctccgatctcttccacgcccccgagcagggggtcggc
gcctcggcgatcggctcgagcgaagcggtgatgctcgccgggatggcgctgaagtggcgc
tggcgcgcgcgtcgccgcgcccgcggcgaggacacccatcgccccaacctgatcctcggc
gccaatgtccaggtggtgtgggagaagttctgtcgttactgggatgtcgagccgcgctac
atcccgatggagaagggccgttatgtcatcaccccggaggaggtgatcgcccgcaccgat
gcgcacaccatcggcgtggtcgccatcctcggcaccaccttcaccggggagtacgagccg
atcgaagcgatccacgccgcgctggaggcgcagaacgccaccaccggctgggagatcccg
atgcacgtcgacgccgccagcggcggcttcgtcgccccctttctcgaccccgagctggtg
tgggacttccgcctgccgctggtcaagtcgatcaacgtctcggggcacaagtacggcctg
gtctatcccggcgtcggctgggtggtgtggcgcagccacgaggacctgcccgaggagctg
atcttccgggtcaactatctcggcggcgacatgccaaccttcaccctcaacttctcccgc
cccggcaaccaggtggtgggtcagtactacaacttcctgcgcctggggcgcgccggctac
acccaggtaatgacggcgctgcgcgaggtggccacggggctggcgcgcggcgtcgccgac
ctcggccccttcgagctggtcagcgacgccagcaccatcccggtgttcgccttcaagctg
cgcgacgagatcaccgactacagcgtcttcgacatctcccacaagctgcgcgagagcggc
tggcaggtgcccgcctacaccatgcccgagcacgccgagtcggtcgcggtgctgcgcgtg
gtggtgcgcgagggcttcagcgccgatctcgccgagctgctgctcgccgacctcgccaag
gccgtcgcccacttcgaggggctgcgcgcacacgacccggcgccgcccacgcccagcttc
gcccactga

DBGET integrated database retrieval system