KEGG   Mycolicibacterium rhodesiae: MycrhN_0818
Entry
MycrhN_0818       CDS       T01685                                 

Definition
(GenBank) tartrate dehydrogenase
  KO
K07246  tartrate dehydrogenase/decarboxylase / D-malate dehydrogenase [EC:1.1.1.93 4.1.1.73 1.1.1.83]
Organism
mrh  Mycolicibacterium rhodesiae
Pathway
mrh00630  Glyoxylate and dicarboxylate metabolism
mrh00650  Butanoate metabolism
mrh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MycrhN_0818
   00650 Butanoate metabolism
    MycrhN_0818
Enzymes [BR:mrh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.83  D-malate dehydrogenase (decarboxylating)
     MycrhN_0818
    1.1.1.93  tartrate dehydrogenase
     MycrhN_0818
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.73  tartrate decarboxylase
     MycrhN_0818
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-ProteinID: AEV71449
UniProt: G8RQP3
LinkDB
Position
840735..841796
AA seq 353 aa
MTGPAIQSVAVIPGDGIGPEVIESARAVLDTIAAKHGIELSYTDFDWSCERYTRDGAMMP
ADGIERLRDFDAILLGAVGWPGVPDHVSLWGLLIPIRRAFRQYVNLRPIKVFDGVESPLR
APGEVDFVVVRENVEGEYSEIGGRLNRGFPDEMAVQESVFTRVGVSRIADYAFELARSRR
GYVTSATKSNGIVHTLPFWDEVVAERAALFPDVLTDSEHIDALAAKFVLQPHRFDVVVGS
NLFGDILSDLAAAVAGSIGIAPSGNLDPTKEYPSMFEPVHGSAPDIAGRGIANPIGAVWS
AALMLEHLGHAAAAGEVLAAMEATLAKPETRTGDLGGTASTVEVTEALVEQLR
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgactgggccggcaattcagtccgtcgcggtgattccgggcgacgggatcggcccggag
gtcatcgaatccgcacgggcggtgctcgacaccatcgctgccaagcacggaatcgagttg
tcctacacggacttcgactggtcgtgtgagcgatacacgcgcgacggcgcgatgatgccc
gcggacggcatcgagcggcttcgcgatttcgatgcgatcctgttgggtgcggtcggctgg
ccgggagtgcccgaccacgtctcgctgtggggtctgctgatcccgatccggcgggccttc
cgtcagtacgtcaacctgcgtccgatcaaggtgttcgacggtgtcgagagcccactgcgg
gcgccgggcgaggtcgacttcgtggtggtgcgtgagaatgtcgagggtgagtacagcgag
atcggcggacgactcaatcgcgggttccccgacgagatggccgtccaggagtcggttttc
acccgggtcggggtgagccgcatcgcggactacgccttcgagctggcgcggtcgcggcgt
gggtacgtcacgtcggcgacgaagtcgaacggcatcgtgcacacgctgccgttctgggac
gaggtcgtcgcggagcgggccgccctgttcccggacgtgctgacggacagcgagcacatc
gacgcgctggcggcgaaattcgtactccagccgcaccgcttcgacgtcgtggtggggtca
aatctgttcggcgacatcctctctgacctcgccgcagccgtcgcggggtcgatcgggatc
gcgccgtcgggcaacctggacccgacgaaggagtatccgtcgatgttcgagccggtgcac
ggttcggctcccgacatcgcgggacgcgggatcgccaatccgatcggcgcggtgtggtcg
gcggcgctgatgctcgagcacctgggtcacgccgccgcggcgggtgaggtgttggcggcg
atggaggccacactggcgaagccggaaacccgcaccggggatctcggcgggactgcgtcg
acggtcgaggtcacggaagcgctcgtcgagcaattgcggtga

DBGET integrated database retrieval system