KEGG   Mycolicibacterium rhodesiae: MycrhN_5469Help
Entry
MycrhN_5469       CDS       T01685                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
mrh  Mycolicibacterium rhodesiae
Pathway
mrh00250  Alanine, aspartate and glutamate metabolism
mrh00280  Valine, leucine and isoleucine degradation
mrh00310  Lysine degradation
mrh00410  beta-Alanine metabolism
mrh00640  Propanoate metabolism
mrh00650  Butanoate metabolism
mrh01100  Metabolic pathways
mrh01120  Microbial metabolism in diverse environments
Module
mrh_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mrh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    MycrhN_5469
   00650 Butanoate metabolism
    MycrhN_5469
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MycrhN_5469
   00280 Valine, leucine and isoleucine degradation
    MycrhN_5469
   00310 Lysine degradation
    MycrhN_5469
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MycrhN_5469
Enzymes [BR:mrh01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     MycrhN_5469
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     MycrhN_5469
    2.6.1.48  5-aminovalerate transaminase
     MycrhN_5469
Amino acid related enzymes [BR:mrh01007]
 Aminotransferase (transaminase)
  Class III
   MycrhN_5469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Na_Pi_cotrans
Motif
Other DBs
NCBI-ProteinID: AEV75942
UniProt: G8RIN5
LinkDB All DBs
Position
5558352..5559692
Genome map
AA seq 446 aa AA seqDB search
MSTLEQSRYLATEIPGPLSKALIDRKSAAVSRGVGNTMSVYASRAFGGIVEDVDGNRLID
LGSGIAVTTIGNSSPAVVAAVQDQVARFTHTCFMITPYEGYVAVAEQLNRLTPGSGEKRS
ALFNSGSEAVENAIKVARTYTRKQAVVSFDHAYHGRTNLTMALTAKSMPYKHGFGPFAPE
VYRAPLSYPFRDAEFGKEMATDGELAAKRAIAVMDKQVGADNLAAVIIEPIQGEGGFIVP
ADGFLPALLNWCRDNNVVFIADEVQTGFARTGAMFACEHEGIEPDLIVTAKGIADGMPLS
GVTGRAEIMDAPHVSGLGGTYGGNPVACAAALATIETIEADGLVERAQQIEALMKDRLGR
LQAEDDRIGDVRGRGAMIAMELVKAGSIEPDPDLTKALCAGCHAAGVIVLSCGTFGNVLR
FLPPLTISDDLLIEGLDVLALVLKDL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
ttgagcaccctcgaacagagccgctacctcgccaccgagattcccggcccgctgtcgaag
gcgctgatcgacaggaagagcgccgccgtgtcccgcggggtgggcaacacgatgtcggtg
tacgcgtcgcgggcgttcggcggcatcgtcgaagacgtcgacggcaaccggctcatcgac
ctgggctcgggcatcgccgtgaccaccatcggaaactcgtcgcctgccgtcgtcgccgca
gtgcaggatcaggtggccaggttcacccacacgtgtttcatgatcacgccgtacgagggg
tacgtggcggtcgccgagcagctcaaccggctcacgcccggcagcggcgagaagcggtcg
gcactgttcaactccggctcggaggcggtcgagaacgcgatcaaggtggcgagaacctat
acccgcaagcaggccgtggtgtcgttcgatcacgcgtaccacggcaggaccaacctcacg
atggcgttgaccgcgaagtcgatgccctacaagcacggcttcggcccgttcgcgcccgag
gtctaccgcgccccgctgtcatacccgttccgcgacgccgagttcggcaaggagatggcc
accgacggcgagctcgccgccaaacgggcaatcgcggtgatggacaagcaggttggcgcc
gacaacctcgccgcggtgatcatcgaacccatccagggtgagggcggcttcatcgtgccc
gccgacggattcctgcccgcgctgctgaactggtgccgcgacaacaatgtggtgttcatc
gccgacgaggtgcagaccggcttcgcccgtaccggagcgatgttcgcgtgcgaacacgaa
ggcatcgagcccgacctcatcgtcaccgccaagggcatcgccgacggtatgccgctgtcg
ggggtcaccgggcgcgccgagatcatggacgcaccgcatgtcagcgggctcggcggcacc
tacggcggcaatcccgtcgcctgcgccgcggcgctggccaccatcgagacgatcgaggcc
gacggcctcgtcgaacgggcgcagcagatcgaagcgttgatgaaggaccgactgggacgg
ctgcaggccgaggacgatcggatcggtgacgttcgtggccgcggcgcgatgatcgcgatg
gagttggtgaaggccggcagcatcgagccggaccccgacctgaccaaagcactgtgcgcc
ggatgccacgcggccggagtgatcgtgttgtcctgcggcacattcggcaatgtgttgcga
ttccttcctcccctgaccatcagcgacgaccttctgatcgaaggtctcgacgtccttgct
cttgttctgaaagacctgtga

DBGET integrated database retrieval system