KEGG   Mycobacterium sp. JS623: Mycsm_02726Help
Entry
Mycsm_02726       CDS       T02423                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
msa  Mycobacterium sp. JS623
Pathway
msa00250  Alanine, aspartate and glutamate metabolism
msa00280  Valine, leucine and isoleucine degradation
msa00310  Lysine degradation
msa00410  beta-Alanine metabolism
msa00640  Propanoate metabolism
msa00650  Butanoate metabolism
msa01100  Metabolic pathways
msa01120  Microbial metabolism in diverse environments
Module
msa_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:msa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Mycsm_02726
   00650 Butanoate metabolism
    Mycsm_02726
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mycsm_02726
   00280 Valine, leucine and isoleucine degradation
    Mycsm_02726
   00310 Lysine degradation
    Mycsm_02726
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mycsm_02726
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:msa01007]
    Mycsm_02726
Enzymes [BR:msa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Mycsm_02726
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Mycsm_02726
    2.6.1.48  5-aminovalerate transaminase
     Mycsm_02726
Amino acid related enzymes [BR:msa01007]
 Aminotransferase (transaminase)
  Class III
   Mycsm_02726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AGB23054
UniProt: L0IVD1
LinkDB All DBs
Position
complement(2666336..2667676)
Genome map
AA seq 446 aa AA seqDB search
MSTLEQSRYLATAIPGPRSQQLIDRKSAAVSRGIGNTMPVYAARAFGGIVEDVDGNRLID
LGSGIAVTTIGNSSPRVVAAVAEQVAQFTHTCFMITPYEGYVAVAEQLNRLTPGSGKKRS
ALFNSGSEAVENAIKIARTYTRKQAVVSFDHAYHGRTNLTMALTAKSMPYKHGFGPFAPE
IYRAPLSYPFRDAEYGKELATDGELAAKRAISVIEKQVGADNLAAVIIEPIQGEGGFIVP
ADGFLPALLDWCRDNNVVFIADEVQTGFARTGAMFACEHEGIEPDLICTAKGIADGLPLS
AVTGRAEIMDAPHVSGLGGTYGGNPVACAAALATIETIESDGLIERARQIETLMKDRLGR
LQAENDRIGDVRGRGAMIAMELVKPGTLEPDAELTMKLCVGCHTAGVIVLSCGTFGNVLR
FLPPLTISDELLIEGLDVLALVLADL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
ttgagcactctcgagcaaagccgctacctcgctaccgcgattcctgggccacggtcacaa
cagctgatcgaccgcaagagcgccgcggtgtcccgcgggatcggcaacaccatgcccgtc
tacgccgcgcgagcgttcggcggcatcgtcgaagatgtcgacggcaaccgactcatcgac
ctgggctcgggtatcgccgtcacgacgatcggcaattcgtcaccacgtgtggtggcggcg
gtggccgagcaggtcgcgcagttcacgcacacctgcttcatgatcacgccctacgagggt
tacgtcgcggtagccgaacagctcaaccgactgacgccgggcagcggtaagaagcggtcg
gcgctgttcaactccgggtcggaagcggtcgaaaatgcgatcaagatcgccaggacctac
acgcgcaaacaggccgtggtgtcgttcgaccacgcctatcacggcaggaccaacctgacg
atggcgctgaccgcaaagtcgatgccgtacaagcatggcttcggcccgttcgcgcccgag
atctaccgcgcgccactgtcgtacccgttccgcgacgccgaatacggcaaggagctcgcg
accgatggcgaactggccgccaagcgggcgatctcggttatcgagaagcaggtcggggcg
gacaacctggccgcggtgatcatcgaaccaatccagggcgagggcgggttcattgttccc
gcagacggtttcctgcccgcactgctcgattggtgccgcgacaacaacgtggtgttcatc
gccgacgaggtgcagaccgggttcgcccgcacgggagcgatgttcgcgtgcgaacacgaa
ggcatcgagcccgacttgatctgcaccgcgaagggtatcgctgacggtctgccgctgtcg
gcggtcaccggccgcgcggagatcatggatgctccgcatgtcagcgggctgggcgggacg
tacggcggcaacccggtggcatgcgcggcggcgctggccaccatcgaaacgatcgagtcc
gacgggctgatcgagcgtgcacgccaaatcgagacattgatgaaggaccgccttgggcgg
ctgcaggccgagaacgaccgcatcggcgacgtgcgcggccgtggcgcgatgatcgcgatg
gagttggtcaagcccggcacgctggagcccgacgcggagctgaccatgaagctgtgcgtc
ggttgccacaccgcgggcgtaatcgtgttgtcctgcggcacatttggcaatgtcctacgg
ttcctgccgccgctgaccatcagcgacgaactgctcatcgaaggcctcgacgtcctcgct
ctcgtcctggccgacctctaa

DBGET integrated database retrieval system