KEGG   Mycolicibacterium smegmatis MC2 155: LJ00_00630Help
Entry
LJ00_00630        CDS       T03433                                 

Definition
(GenBank) GntR family transcriptional regulator
Organism
msb  Mycolicibacterium smegmatis MC2 155
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FCD GntR PaaX Rrf2 HTH_11 MarR_2 HTH_41 HTH_24 FadR_C HTH_Crp_2 TrmB
Motif
Other DBs
NCBI-ProteinID: AIU05406
UniProt: I7FCI4 A0QNQ3
LinkDB All DBs
Position
complement(146548..147231)
Genome map
AA seq 227 aa AA seqDB search
MSTSLAQRVVAGLKDKIFAGDLPPGHKLPSEAELIDEFGVSRTVVREAVTRLRAEGLIET
FQGRGSFVLAVPEPTAFTIESAAIRTQRDVLDMVDFRLGVECEAAALAAARIDARGRDAV
RTALDEFVGAAPEDAVEADFRFHRTIAEVSGNRFYLDLLNSLGPMMIMLPRTRLGDAHSI
TDAAHAERVRREHDQVAAAVAAGDPDLARAAMRLHLGNTRRRLAGDR
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacatcgctggcgcagcgggtggtcgccgggctgaaggacaagatcttcgccggc
gacctgccgcccggccacaaactgccgtccgaggccgagctcatcgacgagttcggggtg
tcgcgcaccgtggtgcgtgaggccgtcacacgcctgcgtgccgagggtctcatcgaaacc
ttccagggccgagggtctttcgtactcgcggtgcccgaacccaccgcgttcaccatcgag
tccgcggccatccggacccaacgcgacgtgctcgacatggtggacttccgcctcggtgtg
gaatgcgaggcggccgcactggccgccgcgcgcatcgatgcccgcggccgcgacgcggtc
cgtaccgcgctcgacgaattcgtcggcgccgcaccggaggacgccgtcgaggccgacttc
cgattccaccgcacgattgccgaggtcagcgggaaccggttctacctcgacctgttgaac
tcgctgggtcccatgatgatcatgctgccgcgcacgcgcctgggcgacgcgcattcgatc
accgacgccgcgcacgccgagcgggtccgccgtgagcacgatcaggtggcggccgcggtg
gccgcaggggacccggatctggcgcgggccgccatgcgcctacaccttggtaacactcga
cggcgtctcgccggtgacaggtga

DBGET integrated database retrieval system