Mycobacterium seoulense: MSEO_07810 Help Entry MSEO_07810        CDS       T07134                                  Name (GenBank) hypothetical protein   KO K03210   preprotein translocase subunit YajC Organism mseo  Mycobacterium seoulense Pathway mseo02024   Quorum sensing mseo03060   Protein export mseo03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:mseo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     MSEO_07810  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     MSEO_07810  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     MSEO_07810  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:mseo02044]     MSEO_07810 Secretion system [BR:mseo02044]  Sec (secretion) system   Prokaryotic Sec-SRP core components    MSEO_07810 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YajC Motif Other DBs NCBI-ProteinID:  BBY00282 UniProt:  A0A7I7NWR8 LinkDB All DBs Position 764677..765018 Genome browser AA seq 113 aa AA seqDB search MESLILFLPFLLIMGGFMYFASRRQKRAMQATIDLHESLRAGDRVHTTSGLQATVVAITD DTVDLEIAPGVVTTWMKLAIRDRVLPEDDEDLADGDDSDDVAEFDEGRLPKDS NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggagagtttgatcctgttcctgcccttcctgctcatcatgggcgggttcatgtacttc gcgtcgcggcgccagaagcgcgcgatgcaggccaccatcgacctgcacgagtcgctgcgg gccggcgaccgcgtgcacaccacctccggccttcaggccacggtcgtcgcgatcacggac gacaccgtcgacctcgagatcgcgccgggcgtggtgaccacctggatgaagctggccatc cgcgaccgggtcctgcccgaggacgacgaagacctggccgacggcgacgactcggacgac gtggccgaattcgacgagggccggctgcccaaggattcctga

DBGET integrated database retrieval system