KEGG   Mycolicibacterium gilvum Spyr1: Mspyr1_31600Help
Entry
Mspyr1_31600      CDS       T01376                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase apoenzyme
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
msp  Mycolicibacterium gilvum Spyr1
Pathway
msp00250  Alanine, aspartate and glutamate metabolism
msp00280  Valine, leucine and isoleucine degradation
msp00310  Lysine degradation
msp00410  beta-Alanine metabolism
msp00640  Propanoate metabolism
msp00650  Butanoate metabolism
msp01100  Metabolic pathways
msp01120  Microbial metabolism in diverse environments
Module
msp_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:msp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Mspyr1_31600
   00650 Butanoate metabolism
    Mspyr1_31600
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mspyr1_31600
   00280 Valine, leucine and isoleucine degradation
    Mspyr1_31600
   00310 Lysine degradation
    Mspyr1_31600
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mspyr1_31600
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:msp01007]
    Mspyr1_31600
Enzymes [BR:msp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Mspyr1_31600
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Mspyr1_31600
    2.6.1.48  5-aminovalerate transaminase
     Mspyr1_31600
Amino acid related enzymes [BR:msp01007]
 Aminotransferase (transaminase)
  Class III
   Mspyr1_31600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ADT99776
UniProt: E6TD68
LinkDB All DBs
Position
3295172..3296524
Genome map
AA seq 450 aa AA seqDB search
MSALEQSRHLATAIPGPRSVELASRKNTAVSRGVGTTMPVYAARAFGGIVEDVDGNRLID
LGSGIAVTTVGNASPRVVAAVAEQAAEFTHTCFMVTPYEGYVAVAEALNRLTPGDGDKRS
ALFNSGSEAVENAVKIARTFTRKQAVVSFDHAYHGRTNLTMALTAKSMPYKHGFGPFAPE
IYRAPMSYPFRDAEFGGKELATDGELAARRAITVIDKQVGAGNLAAVIIEPIQGEGGFIV
PAEGFLPTLLDWCRANDVVFIADEVQTGFARTGAMFACEHEGPDGLVPDLIVTAKGIAGG
MPLSAVTGRADIMDAPHVSGLGGTYGGNPVACAAALATIETIESDNLVARAAQIEALMKD
RLGRMQAEDDRIGDVRGRGAMIAVELVKSGTLEPDPELTRKLLTAAHAAGVIVLSCGTFG
NVLRFLPPLAISDDLLLEGLDILELILRDL
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgctctcgaacagagccgccacctcgccaccgcgattcccggcccccggtccgtg
gaactggcgagccgaaagaacacggcggtgtcccgcggcgtcggcaccaccatgccggtc
tacgcggcgcgcgccttcgggggcatcgtcgaggacgtcgacggcaaccggctgatcgat
ctgggctccgggatcgcggtcaccaccgtcggcaacgcgtcaccgcgggtcgtcgccgca
gtggctgagcaggcggccgagttcacccacacgtgcttcatggtcaccccgtacgaggga
tacgtcgcggtcgccgaggccctcaaccggctgacacccggagacggcgacaagcggtcg
gcgttgttcaactccggctccgaggccgtcgagaacgcggtcaagattgccaggacattc
acacgcaagcaggcggtcgtgtccttcgaccacgcctatcacggccgcaccaacctcacg
atggcgctcaccgcgaagtcgatgccctacaagcacgggttcggacccttcgccccggag
atctaccgtgccccgatgtcctatccgttccgcgacgccgagttcggcggtaaggagctg
gccaccgacggcgagttggccgcgcgtcgtgcgatcaccgtgatcgacaagcaggtcggc
gccggcaatctcgccgcggtgatcatcgagccgatccagggcgagggcggtttcatcgtg
cccgccgagggtttcctgccgacgctgctggactggtgccgggccaatgacgtcgtgttc
atcgccgacgaggtgcagaccgggttcgcgcgcacgggcgcgatgttcgcctgcgagcac
gaaggccctgacgggttggtccccgacctcatcgtgaccgcgaagggcatcgccggcggc
atgcccctgtcggcggtcaccggtcgcgccgacatcatggacgccccgcatgtcagcggc
ctcggcggcacgtacggcggcaacccggtcgcgtgcgcggcggccctcgccaccatcgag
accatcgagtccgacaacctggtggcgcgggcggcgcagatcgaagcgctgatgaaggac
aggctgggtcgcatgcaggccgaggacgaccgcatcggcgatgtccgcggcaggggcgcg
atgatcgccgtcgagctcgtcaagtccggaaccctggagccggacccggagctcacccgg
aagttgctgaccgccgcacacgcggcgggggtcatcgtgttgtcctgcggcacgttcggc
aacgtgctgcgattcctgccgccgctggccatcagcgacgacctcctgctcgaaggcctc
gacatcctcgaactcatcctgcgcgacctgtag

DBGET integrated database retrieval system