KEGG   Marinobacter salarius: AU15_05265Help
Entry
AU15_05265        CDS       T03593                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
msr  Marinobacter salarius
Brite
KEGG Orthology (KO) [BR:msr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AU15_05265
Enzymes [BR:msr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AU15_05265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like FAD_oxidored DAO AlaDh_PNT_C FAD_binding_3 Glutaredoxin K_oxygenase FMO-like NAD_binding_8 Thi4 DUF2190
Motif
Other DBs
NCBI-ProteinID: AHI30971
UniProt: W5YPE1
LinkDB All DBs
Position
1114317..1115909
Genome map
AA seq 530 aa AA seqDB search
MLDASIKEQLNAYMDKLQQPIELVAAYDDSEKSQELKQLLDELEPMSDKISLRTEESEQV
RRPSFAINRVGSDIGVRFAGIPMGHEFTSLVLALLQVGGHPPKASQEVIEQVKDLDGDFE
FETYFSLSCQNCPDVVQALNLMSVLNPRIKHTAIDGALFQDEVEQREVMAVPSVYLNGKP
FGQGRMTLEQIIAKVDTGAEARDAEKLQQKDPFEVLVIGGGPAGSSAAIYAARKGISTGI
AAERFGGQVADTMGIENLISVPYTEGPKLVAAMEQHVKEYDVDIMNLQRAEKLIPAARKG
GYHEVRLANGASLKSRTLVLSTGARWRQMGVPGEEEYRNKGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVGHVTLIEFGAAMRADDVLQKKLRSLKNVEIITSGQTTEITGE
NGKVNGLQYTDRTTGESHHVSLEGVFVQIGLVPNTEWLKGDIELSQYGEIIVDDRGETSI
PGVFAAGDATTVPYKQIVISMGEGSKAALSAFDFLIRNSVDESESDEAAA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgccagtatcaaggaacagttgaacgcttacatggacaagctgcagcagccg
atcgagctggttgccgcttatgacgacagcgaaaagtcccaggaactgaagcagttgctg
gacgagctcgagcccatgtctgacaagatcagcctgcgcacggaagagtcagagcaagta
cgtcgcccgtcatttgccattaatcgtgttggcagcgacatcggcgtgcgattcgccggc
atccccatgggccatgaatttacctcccttgttctggcgctgttgcaggtaggtggtcat
ccgcccaaggccagccaggaagtgattgaacaggtcaaagacctggacggcgactttgag
tttgaaacctacttctcgctgtcgtgccagaactgtccggacgtggtccaggcgctgaac
ctgatgagcgtcctcaatccaaggatcaagcatacggcgatcgacggtgccctgttccag
gatgaagtggagcagcgtgaagtcatggcagtgcccagcgtttatctcaatggcaagccg
tttggccagggccgcatgactctggagcagattatcgcgaaggtcgacactggtgcagag
gctcgtgacgctgagaagctccagcaaaaagacccgttcgaggtgctggtcattggaggt
ggcccggcgggttcttcagccgctatctatgcggcgcgcaagggtatctctaccggtatc
gccgcagaacgcttcggtggccaggtggcggacaccatgggcatcgagaacctgatctct
gtgccctacaccgagggtcccaagctggtggcggccatggagcagcacgtcaaggaatat
gatgtagacatcatgaacctgcagcgcgctgaaaaactgatcccggcggcccgtaagggt
ggctaccacgaagtgcgtctggccaatggcgcctctttgaagagccgcacgctggttctg
tccaccggcgctcgctggcgccagatgggtgttccgggagaagaggaataccgcaataaa
ggtgtggcctattgcccgcactgcgacggccccttgttcaagggcaagcgtgtggcggtg
atcggcggcggtaactccggcgtggaagcggccatcgacctggcgggtattgttggccac
gtgactctgattgagttcggcgctgccatgcgcgcagacgatgtgctgcagaagaaactg
cgcagcctgaagaacgtggaaatcattacctcgggccagaccactgagattaccggcgag
aacggcaaggtgaacggccttcagtataccgaccgcacaaccggagagagccaccatgta
tcgttggaaggtgtgttcgtccagattggcctggtgccgaacaccgagtggctgaaaggt
gacatcgagctgagccagtatggcgagatcattgtcgacgaccggggcgaaacctccatc
ccgggcgtgtttgcggccggtgacgctaccaccgtgccctacaagcagatcgtgatctct
atgggtgaaggctccaaggccgccctgagcgcgttcgacttcctgattcgaaactccgtt
gatgagagcgagagtgacgaagctgcggcctga

DBGET integrated database retrieval system