KEGG   Methanosarcina siciliae HI350: MSSIH_3781Help
Entry
MSSIH_3781        CDS       T03864                                 

Definition
(GenBank) Aspartyl-tRNA(Asn) amidotransferase subunit A / Glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
msz  Methanosarcina siciliae HI350
Pathway
msz00970  Aminoacyl-tRNA biosynthesis
msz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msz00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MSSIH_3781
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:msz03029]
    MSSIH_3781
Enzymes [BR:msz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     MSSIH_3781
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     MSSIH_3781
Mitochondrial biogenesis [BR:msz03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    MSSIH_3781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AKB34471
UniProt: A0A0E3LBW3
LinkDB All DBs
Position
complement(4803698..4805125)
Genome map
AA seq 475 aa AA seqDB search
MAKWMSVAQVKEKIRESSAEEVTAEYLEAIGKSKINGYITVSHKALEQAKKIDVEGYEGP
LAGVPIAIKDNISVVGLPNSCGSKILEGYVPPFNAHVIEKLLDAGAVILGKTNLDEFAMG
SSTETSYFGPTANPWDIERVPGGSSGGSAAVVAAGEAPFALGSDTGGSVRCPAAFCGVVG
LKPTYGAVSRYGVVAYANSLEQVGPLANNVEDIAVLMDVIAGYDKRDSTSIDSKTEYRKA
LVDDVKDLKIGVPKEFFGEGIHSGVEKAVWDAIHKFESLGATWQEVSMPNINYALASYYI
IAMSEASSNLARFDGTRYGFRENGENWHAMVSKTRAEGFGTEVKRRILLGTYALSAGYHD
KYYLKALKVRTLVKQDFDKALSTVDLLMAPTMPNPAFKIGEKIEDPLTLYLSDVNTCPIN
LAGVPSVSVPCGFTDGLPVGLQIMGKPFDEPTVLRAAYTFEKNTDYHTKRPPEVA
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaatggatgagtgttgcacaggttaaagagaagatcagggaaagctcagccgaa
gaagtaacagccgaatacctcgaagctatcggaaaaagcaaaatcaacggttatataacg
gtttcccataaagccctcgaacaggcaaaaaagattgatgttgaagggtacgaaggcccc
cttgcaggtgtgccaatcgcaataaaggacaatatttccgtagtagggcttccaaacagc
tgtggctcgaaaatccttgaaggctatgttcccccattcaatgctcacgtaatcgaaaaa
cttcttgatgccggagccgtaatccttggaaaaaccaaccttgatgagtttgcaatgggg
tcgtctacggaaaccagctatttcgggccaaccgcaaacccctgggacattgaaagagta
cctggcggatcttccggaggcagtgcagcagttgttgcagccggagaagccccttttgcc
cttggttcggacacaggtgggtctgtgcgctgtcctgcagctttctgtggagttgtggga
cttaaaccgacctatggggctgtttcaaggtacggggttgtggcttacgcaaattccctt
gaacaggtcggacctcttgcaaacaacgtggaagatattgcagtcctgatggatgtcata
gcaggttatgacaaaagagattccacttccattgacagcaaaacagaatacaggaaagct
cttgttgacgacgtaaaagatctgaagataggggttccgaaagagtttttcggagaaggt
atccattcgggtgtggaaaaagccgtatgggacgcaatccacaaatttgaaagcctcgga
gcgacctggcaggaagtttcgatgcccaacataaattatgctcttgcttcatattatatc
attgcaatgagtgaagcgtcctcaaaccttgcccgctttgacggaacacgttacggattc
agagaaaatggggaaaactggcacgcaatggtctcaaagaccagagccgaagggttcgga
accgaagttaagcgaagaattctcctcgggacctatgcgctttctgcaggttaccatgac
aagtattacctcaaagctctgaaggtcaggacccttgtcaagcaggactttgataaggct
ctctcaacagttgacctgctcatggcgccgaccatgccaaatcctgccttcaaaataggg
gagaagattgaagacccgcttaccctctacctctcggacgtaaacacctgcccgatcaac
ctcgcaggcgtaccttcagtttccgtaccctgcggctttactgacggactgcctgtggga
ctccagataatgggcaaaccctttgatgagccgactgtccttagggcagcctatactttt
gagaagaataccgattaccacacaaagagacctccggaggtggcgtaa

DBGET integrated database retrieval system