KEGG   Mycolicibacter terrae: 4434518_02309Help
Entry
4434518_02309     CDS       T05465                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
mter  Mycolicibacter terrae
Pathway
mter00250  Alanine, aspartate and glutamate metabolism
mter00280  Valine, leucine and isoleucine degradation
mter00310  Lysine degradation
mter00410  beta-Alanine metabolism
mter00640  Propanoate metabolism
mter00650  Butanoate metabolism
mter01100  Metabolic pathways
mter01120  Microbial metabolism in diverse environments
Module
mter_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mter00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    4434518_02309 (gabT)
   00650 Butanoate metabolism
    4434518_02309 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    4434518_02309 (gabT)
   00280 Valine, leucine and isoleucine degradation
    4434518_02309 (gabT)
   00310 Lysine degradation
    4434518_02309 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    4434518_02309 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mter01007]
    4434518_02309 (gabT)
Enzymes [BR:mter01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     4434518_02309 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     4434518_02309 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     4434518_02309 (gabT)
Amino acid related enzymes [BR:mter01007]
 Aminotransferase (transaminase)
  Class III
   4434518_02309 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: SNV76303
UniProt: A0A1X2E1J9
LinkDB All DBs
Position
1:2500932..2502278
Genome map
AA seq 448 aa AA seqDB search
MSVPPLPQSRHLATEIPGPGSVRLAGRRAAAVARGVASTLPVYAARAAGGIVEDVDGNRL
IDLGSGIAVTTVGNAAPRVVAGVREQVGEFTHTCFMVAPYEGYVAVAEALNRLTPGKFEK
RSVLLNSGAEALENAVKIARSYTRKSAVVAFDHGYHGRTNLTLALTAKSMPYKSGFGPFA
PDVYRAPASYPYRDGLVDKELGSDGERAAERTIGVLENQIGANNLAALVIEPIQGEGGFI
VPAPGFLPALLAWCRDNDVVFIADEVQTGFARTGAMFACEHEPIAPDLICTAKGIGGGLP
LSAVTGRAEIMDAPQVSGLGGTFGGNPVACAAALGALATVEADDLIGRAQQIERVVFERL
GRLQADDDRIGDVRGRGAMIAVELVRPDSADPDPALTKALATACHQAGVIVLTCGTFGNV
LRLLPPLTISDELLADGLDVLAGELAKL
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgccgccgctgccgcagagccgtcacctggccaccgagatccccggccccggc
tcggtgcggctggcggggcgccgcgcggcggccgtggcgcgcggggtggccagcacgttg
ccggtctacgcggcgcgcgccgccgggggcatcgtggaggacgtcgacggcaaccggctg
atcgatctgggctcgggcatcgcggtgacgaccgtcggcaatgccgcgccgcgcgtggtt
gccggggtgcgtgaacaggtcggcgagttcacccacacctgcttcatggtggcgccctac
gaggggtatgtggccgtcgccgaggcactgaaccggctcaccccgggcaaattcgagaag
cgctcggtgctgctcaactccggcgccgaagccctggagaatgccgtcaagatcgcccgg
tcctacacccgtaaatccgcggtggtcgcgttcgaccacggctatcacggccgtaccaac
ctgacgttggcactgacggccaagtcgatgccctacaagagcgggttcgggccgttcgcg
cccgacgtctatcgcgcgccggcgtcctacccctaccgggacgggctggtcgacaaggag
ttgggcagcgacggcgaacgggccgccgaacgcaccatcggtgtgctggagaaccagatc
ggcgccaacaacctggccgcgctggtcatcgaaccgatccagggcgagggcgggttcatc
gttccggcgccgggttttctgcccgcactgctggcgtggtgccgcgacaacgatgtggtg
ttcatcgccgatgaggtccagaccggcttcgcgcgcaccggcgcgatgttcgcctgcgag
cacgaacccatcgcgccggatctgatctgcaccgccaagggcatcggcggggggctaccg
ctgtcggcggtgaccggtcgggccgagatcatggacgcaccccaggtcagcggcctgggt
gggacgttcggcggcaacccggtggcatgcgcggccgcgctgggggcgctggccaccgtc
gaagccgacgatctgatcggccgggcccagcagatcgagcgggtggtgttcgagcggctg
ggtcgcctgcaggccgacgacgaccgcatcggcgacgtccgtggccgcggcgccatgatc
gccgtcgagctggtgcggcccgacagcgccgatccggacccggcgctcaccaaagcgctg
gccacggcgtgccatcaggccggtgtcatcgtgttgacctgcggcacgttcggcaatgtg
ctgcggctgctgccgccgttgaccatcagcgacgaattgctcgccgacggcttggacgtg
ctggccggcgaactggcgaagctctaa

DBGET integrated database retrieval system