KEGG   Mycolicibacter terrae: 4434518_03969Help
Entry
4434518_03969     CDS       T05465                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase LigC
Organism
mter  Mycolicibacter terrae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: SNV94414
UniProt: A0A1X2E4R5
LinkDB All DBs
Position
1:complement(4196954..4197997)
Genome map
AA seq 347 aa AA seqDB search
MNTMDLPVAPPVAPMLAKAAVAVPGEGEAPGRWSYEPKWDGFRAIVFRDDDEVLLQSRNG
KPLGRYFPELLDALRAEVAPRCVLDGEVVVPRRIGGRTRLDWESLSQRIHPAQSRVRMLA
EQTPAQFIGFDVLATGSASLLGEPFSVRREALAELVSGGTSCHVTRATSDPEQARHWLTT
FEGAGLDGVVAKRTDGPYLPGKREMVKIKHRRDADCVVMGYRIHKSGAGIGSLLLGLYRP
DGELAMVGGAAAFSDADRLALLAELEPLRLGDVRDGEPSRWNSAADKQWVPIRPERVAEV
AYDQMEGDRFRHTVKLVRWRPDRDPASCTFDQLDVPLNYELADVLET
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccatggacctgcccgtggcgccgccggtagccccgatgctcgccaaggctgcg
gtcgccgttcccggggagggcgaggcgcccgggcgctggtcctatgaacccaagtgggac
ggtttccgtgccatcgtctttcgcgacgacgacgaggtgctgctgcaatcgcgcaacggc
aaaccgctgggccgttactttcccgaactgctggatgccctgcgcgccgaggtcgccccg
cgctgcgtgctcgacggggaggtggtggtgccacgccggatcggtggacggacccggctg
gactgggagtctttgagccagcgcatccatcccgcccagagccgggtgcggatgctggcc
gagcagaccccggcgcagttcatcggcttcgacgtattggccaccgggtccgcgtcgctg
ctcggcgagccgttttcggtgcgacgggaagcactggccgagctggtgagcggcgggacc
agctgccatgtcacccgcgccacctccgaccccgagcaggccagacactggctcaccacg
ttcgaaggggccgggctcgacggggtggtcgccaagcgcaccgacgggccttatctgccc
ggcaagcgcgagatggtcaagatcaaacaccgtcgcgacgccgactgcgtggtcatgggg
tatcgcatccacaagagcggcgccggcatcggctcgctgctgctgggcctgtaccgcccc
gatggcgagctggcgatggtcggcggtgccgcggcgttcagcgacgccgatcggctggcc
ctgctggccgagctggagccgctgcgcctcggcgacgtccgggacggcgaaccgagccgg
tggaactccgctgccgacaagcagtgggtcccgatccggcccgagcgcgtcgccgaggtc
gcctacgaccagatggaaggcgaccggttccgccacaccgtgaagctggtgcggtggcgt
cccgaccgcgacccggccagctgcaccttcgaccagctcgacgtcccgctgaactacgaa
ctggccgacgtgctggagacctga

DBGET integrated database retrieval system