KEGG   Microbulbifer thermotolerans: A3224_12505Help
Entry
A3224_12505       CDS       T04393                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mthd  Microbulbifer thermotolerans
Pathway
mthd00473  D-Alanine metabolism
mthd00550  Peptidoglycan biosynthesis
mthd01100  Metabolic pathways
mthd01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mthd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A3224_12505
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A3224_12505
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    A3224_12505
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mthd01011]
    A3224_12505
Enzymes [BR:mthd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     A3224_12505
Peptidoglycan biosynthesis and degradation proteins [BR:mthd01011]
 Precursor biosynthesis
  Amino acid ligase
   A3224_12505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp DUF3093 Corona_nucleoca
Motif
Other DBs
NCBI-ProteinID: AMX03290
UniProt: A0A143HPD4
LinkDB All DBs
Position
3006490..3007491
Genome map
AA seq 333 aa AA seqDB search
MINTLLICGGGGSEHQVSLRTADFIERQLCELEEVALERVEMDGNGRLTDRHGQVRRLDQ
DRMLRDENGGAWEVHYVIPAIHGYPGETGDLQSLLDLFGIPYYGCGPEASKICFNKVTTK
LWLSALGIDNTPYQYLSSREPEELAKASMALEEWGQVFVKASNQGSSVGCYKVSSTQELD
RALEQAFALSPYVLVEKCLKVRELEVAVYPYEGKLVITPPGEVCAPAGSFYSYEEKYSDA
SRAVTHVEAPGLSEAQVSWIHEAARRAFVGLQLKDLSRIDFFLTESGEIYLNEVNTFPGM
TSISMFPKMMAHAGHDFRRYMANLIRAAVNRQS
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacaccctgcttatctgcggcggcggtggcagcgaacaccaagtctccctgcgc
accgcagactttatcgagcgccagctgtgcgagctggaagaggtggctcttgagcgcgtg
gaaatggacggcaacggccgcctcactgaccggcacggccaagtgcggcggctggaccag
gatcggatgctgcgcgatgaaaatggcggcgcctgggaagtccactatgtcattcccgcc
atacacggctaccccggtgaaaccggcgatctgcagtcactgctggacttattcggcatc
ccctactacggttgcggccccgaggcgagcaagatttgcttcaacaaggtcaccacaaaa
ctgtggctcagcgcactggggattgataacacgccctatcaatatctctccagccgcgaa
ccggaagagctggccaaagccagcatggcactagaagagtggggacaggtcttcgtcaaa
gcctcgaaccagggatcttcggtgggttgttacaaggtgagttccacacaagaactggac
agggcactggaacaagccttcgccctatccccctatgttttggtggaaaagtgcctgaaa
gtacgtgagctggaagtcgccgtctatccttacgagggtaaattagtcatcaccccgccc
ggcgaagtgtgtgcgccggccggcagcttttacagctacgaggaaaaatactcggacgcc
agccgcgccgtaacccacgtagaagcgcccggtttaagtgaggcccaagtgagctggatt
cacgaagcggcgcggcgcgcctttgtcggcctgcagctcaaggacctgtcgcgcattgac
ttcttcctgaccgaaagcggtgaaatctatttaaatgaagtcaataccttccccggtatg
acctccatctccatgtttcccaagatgatggcgcacgccggccacgatttccgccgctat
atggccaacttgattcgtgcggcagtgaataggcagtcctga

DBGET integrated database retrieval system