KEGG   Mycobacterium tuberculosis RGTB423: MRGA423_07545Help
Entry
MRGA423_07545     CDS       T01994                                 

Definition
(GenBank) putative DNA-3-methyladenine glycosylase I TAGA
  KO
K01246  DNA-3-methyladenine glycosylase I [EC:3.2.2.20]
Organism
mti  Mycobacterium tuberculosis RGTB423
Pathway
mti03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:mti00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    MRGA423_07545
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mti03400]
    MRGA423_07545
Enzymes [BR:mti01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.20  DNA-3-methyladenine glycosylase I
     MRGA423_07545
DNA repair and recombination proteins [BR:mti03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     MRGA423_07545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenine_glyco
Motif
Other DBs
NCBI-ProteinID: AFE12488
LinkDB All DBs
Position
1354723..1355082
Genome map
AA seq 119 aa AA seqDB search
MRRLLADDGIVRNRAKIEATIANARAAADLGSSEDLSELLWSFAPPPRPRPVDGSEIPSV
STESKAMSRELKRRGFRFVGPTTAYALMQATGMVDDHIQACWVPTERPFDQPGCPMAAR
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
gtgcgacggctactcgccgatgacggaatcgtgcgcaaccgcgccaagattgaggcgacg
atcgccaacgcgcgcgcagctgccgatctggggtcgtccgaagacctatccgagctgctg
tggtcgttcgcgccaccgcctcggccccggcccgtcgacggttccgaaattccctcggtc
agcacggaatcgaaggctatgtcgcgtgagttgaagcggcgcgggttccgtttcgtcggg
cccaccaccgcctatgcgttgatgcaggcgaccgggatggtcgacgaccatatccaagca
tgctgggtgcccactgagcgaccttttgaccagccgggctgcccgatggcggcccggtga

DBGET integrated database retrieval system