KEGG   Massilia oculi: DIR46_15505Help
Entry
DIR46_15505       CDS       T05448                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mtim  Massilia oculi
Pathway
mtim00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mtim00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DIR46_15505
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mtim02000]
    DIR46_15505
Enzymes [BR:mtim01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     DIR46_15505
Transporters [BR:mtim02000]
 Other Transporters
  Pores ion channels [TC:1]
   DIR46_15505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: AWL05690
UniProt: A0A2S2DJZ5
LinkDB All DBs
Position
3394539..3395213
Genome map
AA seq 224 aa AA seqDB search
MIVVHHLNNSRSQRILWLLEELGLEYEIKRYQRDPKTMLAPPELKAVHPLGKSPVISDGD
LVVAESGAIVEYLVEQYGQGRLKPAAGTPARLRYSHFLHYAEGSAMPPLLLKLVFDKVEN
SPMPFFVKPIARGIAQKVKGSFVLPQIALHLGYLEAELGKHPWFTGEEFTAADIQLSFPL
EAAASRGGLDGKYPNLLDFLKRIHARPAYGRALERGGKYEIGKA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtcgtccaccacctgaacaattcgcgctcgcagcgcatcctgtggctgctggaa
gagctgggcctggaatacgagatcaagcgctaccagcgcgatcccaagaccatgctggcg
ccgcccgagctgaaggccgtgcacccgctgggcaagtcgcccgtcatcagcgacggcgac
ctggtggtggccgaatccggcgccatcgtcgaatacctggtcgagcagtacggccaggga
cgcctgaaaccggcggccggcactccggcgcgcctgcgctacagccacttcctgcactat
gccgaagggtcggcgatgccgccgctgctgctcaagctggtgttcgacaaggtcgagaac
agcccgatgccgttcttcgtcaagccgatcgcgcgcggcatcgcgcaaaaggtcaagggc
agcttcgtgctgccgcagatcgcgctgcacctgggctacctggaagcggaactgggcaag
catccctggttcaccggcgaagaattcacggcggccgacatccagctcagcttcccgctc
gaggcggccgcctcgcgcggcgggctcgatggcaagtacccgaacctgcttgatttcctg
aagcgcatccatgcgcgcccggcttacgggcgcgcgctcgaacgtggcggcaaatacgag
atcggcaaagcgtaa

DBGET integrated database retrieval system