KEGG   Microbacterium testaceum: MTES_2457Help
Entry
MTES_2457         CDS       T01423                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
mts  Microbacterium testaceum
Pathway
mts00250  Alanine, aspartate and glutamate metabolism
mts00280  Valine, leucine and isoleucine degradation
mts00410  beta-Alanine metabolism
mts00640  Propanoate metabolism
mts00650  Butanoate metabolism
mts01100  Metabolic pathways
mts01120  Microbial metabolism in diverse environments
Module
mts_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mts00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MTES_2457 (gabT)
   00650 Butanoate metabolism
    MTES_2457 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MTES_2457 (gabT)
   00280 Valine, leucine and isoleucine degradation
    MTES_2457 (gabT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MTES_2457 (gabT)
Enzymes [BR:mts01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     MTES_2457 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     MTES_2457 (gabT)
Amino acid related enzymes [BR:mts01007]
 Aminotransferase (transaminase)
  Class III
   MTES_2457 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: BAJ75421
UniProt: E8N6Q7
LinkDB All DBs
Position
2662626..2664065
Genome map
AA seq 479 aa AA seqDB search
MLLYETYMGVPATVQGGECTASRGVRSIAAMSLDTLPTVGGPSLAQERRLVTAIPGPRSQ
ELLDRKAAAVASGVGHTVPIHAVAAGGGVVVDADGNSLIDLGSGIAVTSVGNAHPAVVKA
VQDQVAAFTHTCFMVSPYDSYVAVAEALNRLTPGDHAKKSALFNSGAEAVENAVKIARKH
TGRQAVVAFDHAYHGRTNLTMALTAKNMPYKSGFGPFAAEIYRAPLSYPFRDGLSGPEAA
AKAISLIEKQVGAENLAAVIIEPIQGEGGFIVPADGFLNAIVDWCRDNGVVFIADEVQSG
FARTGAMFASEIFGIVPDLVTTAKGIAGGLPLAAVTGRAEIMDATHTGGLGGTYGGNPIA
CAAALASIDAFENEGLVERAREIGGLLLARLREMQQKDPRVGDVRGHGAMIAAEFVDPAT
GAPDAALTAAVAKAAIAEGVIVLTCGTYGNVIRFLPPLSIGDDLLNEGLDVVAAALARH
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgctcctgtacgagacgtatatgggggtgcctgcgactgtacaggggggagagtgcacc
gcgtcgcgcggcgtccgtagcatcgccgccatgagcctcgacaccctccccaccgtcggc
ggtccctcgctcgcccaggagcgccgcctcgtcaccgccatccccggtccccgctcgcag
gagctgctcgaccgcaaggccgccgccgtggcatccggtgtcgggcacaccgtgccgatc
cacgccgtcgccgcgggcgggggagtcgtcgtcgacgccgacggcaactcgctcatcgac
ctgggctcgggtatcgccgtcacgagcgtcggcaacgcgcaccccgccgtcgtcaaggcc
gtgcaggaccaggtcgccgccttcacccacacgtgcttcatggtctcgccctacgactcg
tacgtcgccgtcgccgaggcgctcaaccgtctcacccccggcgatcacgcgaagaagagc
gcgctgttcaactccggcgccgaggccgtcgagaacgccgtgaagatcgcccgcaagcac
accggccgtcaggccgtcgtcgccttcgaccacgcctaccacggccgcaccaacctcacc
atggcgctcacggccaagaacatgccgtacaagagcggcttcggccccttcgccgccgag
atctaccgcgcccccctctcctacccgttccgcgacggcctctccggccccgaggcggcc
gccaaggcgatcagcctcatcgagaagcaggtcggggccgagaacctcgccgccgtcatc
atcgagcccatccagggcgagggcggtttcatcgtccccgccgacggcttcctcaacgcg
atcgtcgactggtgccgcgacaacggcgtcgtcttcatcgccgacgaggtgcagtcgggc
ttcgcccgcaccggcgcgatgttcgcgagcgagatcttcggcatcgtccccgacctcgtc
accaccgcgaagggcatcgccggcgggctcccgctggcggccgtgacggggcgcgccgag
atcatggatgccacccacacgggcggactcggaggcacgtacggcggcaacccgatcgcg
tgcgccgcggctctggcatccatcgacgccttcgagaacgaggggctggtcgagcgggcc
cgggagatcggcggactgctcctcgcccgcctgcgcgagatgcagcagaaggacccgcgc
gtcggggacgtccgcggacatggcgcgatgatcgcggccgagttcgtcgatcccgccacc
ggcgctcccgacgcggccctcaccgccgccgtcgccaaggccgcgatcgccgagggcgtc
atcgtgctcacgtgcgggacgtacggcaacgtcatccggttcctcccgccgctgtcgatc
ggcgacgacctgctgaacgagggtctcgacgtggtcgcggccgccctcgcccgccactga

DBGET integrated database retrieval system