KEGG   Marivirga tractuosa: Ftrac_3762
Entry
Ftrac_3762        CDS       T01365                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mtt  Marivirga tractuosa
Pathway
mtt00564  Glycerophospholipid metabolism
mtt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Ftrac_3762
Enzymes [BR:mtt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Ftrac_3762
SSDB
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 Pyr_redox_2 HI0933_like Pyr_redox Thi4 GIDA Pyr_redox_3 NAD_binding_8 Lycopene_cycl 3HCDH_N
Other DBs
NCBI-ProteinID: ADR23729
UniProt: E4TR77
LinkDB
Position
4457471..4459036
AA seq 521 aa
MNRKENIKQISDIDKVWDIAVIGGGSSGLGVALDAVSRGLSVALFEKSDFAKGTSSRSTK
LVHGGVRYLAQGDVFLVLEALKERGRLLKNAPHLAHNQSFVIPIYTFFDRLKYTVGLKMY
DWMAGKLSLGKSTFISKEKTIERLPTIKQEGLKGGVVYHDGQFDDARLALNIAQTCDDKG
VAVLNYFKVNQLHKNGEGKITGLSVKDQFSKNNYDIRAKMVVNATGVFADKILQLDNPEA
KKMIRPSQGIHLVLDRSFLSGEDALMIPETSDGRVLFAVPWHDKIVVGTTDTMRKKPKLE
PAALEKEIDFVLATAQEYLTKKPQRSDVLSVYAGLRPLAAPTDESEKTKEISRSHKVIVS
DSNLITLTGGKWTTFRKMGEDTVEYFSKITGDKLKDSTSAAIKIHGYSNEKPIDYIGVYG
ADRIAIKKLQDENSEWNKPLHPKYPYTQAEVIFACRNEMAMKVEDVLARRIRILFLDAKA
SMEMTPKVAELMAKELGKEEAWIEKQLKDFNKLAMRYLIES
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgaatagaaaagaaaacataaagcaaatttcagatatagataaggtctgggatattgcg
gtgataggaggtggttcttctgggcttggtgttgctttagatgctgtttccagaggattg
agtgttgctttatttgaaaaatctgattttgccaaagggacgagcagcagaagtacgaag
ctagtgcatggcggagtgcgatatttagcgcaaggtgatgttttcttggttttggaagct
ttaaaggaaagagggagattattgaaaaatgctcctcatttagcccataaccaatctttt
gtgatcccaatttacacattttttgaccgattgaaatatacggttggtttaaagatgtat
gattggatggctgggaaactaagcttaggtaaatctactttcatctcaaaagaaaaaacg
attgagcgtttgccgaccatcaagcaagaaggcttgaaaggtggggttgtttatcacgat
gggcaatttgatgatgcacgtttagcactgaatatagcacaaacctgcgatgataaggga
gtggctgttttaaactattttaaagtaaatcaactccataaaaatggtgaaggcaaaata
actggactttctgtaaaggatcagttctcaaaaaataattatgatataagagcaaaaatg
gtagtgaatgctactggggtttttgctgataagatattgcaattagataatcctgaagca
aagaaaatgatccgaccaagccagggtattcatttggttttagatcgttcgtttttatct
ggagaagatgccttaatgataccagaaaccagcgatggtcgagttttatttgcggtacct
tggcatgataagattgttgtgggtactactgatactatgcgtaaaaagccaaaattggag
ccagcggctttagagaaagaaattgactttgttttagcaactgctcaagagtacttgacc
aaaaaacctcaaagaagcgatgtgctatctgtttatgcaggtctaagaccattggcagcc
ccaactgatgaaagtgaaaagacaaaagagatttctcgaagccataaagtaatcgtatcg
gatagtaacttaattacgctgactggaggaaaatggactacttttcgtaaaatgggagag
gatacagtggaatatttctccaaaataacgggtgacaaactaaaggacagtacctctgca
gctattaaaattcatggttattctaatgaaaagccaatcgattatataggcgtttatggt
gcggacagaatagccattaaaaaattgcaggatgaaaactcagaatggaataagcccttg
catccaaaatatccttatactcaagcagaagtgatttttgcctgcagaaatgaaatggcc
atgaaagtggaggatgttttagccagaagaataagaattctgtttttggatgctaaggca
agtatggaaatgacacctaaagtagcagagttaatggcgaaagaattaggaaaagaagaa
gcttggattgaaaagcaattgaaagattttaataaattggcaatgcgatatttaattgaa
tcctaa

DBGET integrated database retrieval system