KEGG   Mycobacterium tuberculosis BT2: HKBT2_3487Help
Entry
HKBT2_3487        CDS       T03153                                 

Gene name
glpD2
Definition
(GenBank) glycerol-3-phosphate dehydrogenase Glpd2
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mtuu  Mycobacterium tuberculosis BT2
Pathway
mtuu00564  Glycerophospholipid metabolism
mtuu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtuu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    HKBT2_3487 (glpD2)
Enzymes [BR:mtuu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     HKBT2_3487 (glpD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 GIDA NAD_binding_8 3HCDH_N Pyr_redox HI0933_like AlaDh_PNT_C Thi4
Motif
Other DBs
NCBI-ProteinID: AHJ48284
LinkDB All DBs
Position
complement(3669511..3671268)
Genome map
AA seq 585 aa AA seqDB search
MSNPIQAPDGGQGWPAAALGPAQRAVAWKRLGTEQFDVVVIGGGVVGSGCALDAATRGLK
VALVEARDLASGTSSRSSKMFHGGLRYLEQLEFGLVREALYERELSLTTLAPHLVKPLPF
LFPLTKRWWERPYIAAGIFLYDRLGGAKSVPAQRHFTRAGALRLSPGLKRSSLIGGIRYY
DTVVDDARHTMTVARTAAHYGAVVRCSTQVVALLREGDRVIGVGVRDSENGAVAEVRGHV
VVNATGVWTDEIQALSKQRGRFQVRASKGVHVVVPRDRIVSDVAMILRTEKSVMFVIPWG
SHWIIGTTDTDWNLDLAHPAATKADIDYILGTVNAVLATPLTHADIDGVYAGLRPLLAGE
SDDTSKLSREHAVAVPAAGLVAIAGGKYTTYRVMAADAIDAAVQFIPARVAPSITEKVSL
LGADGYFALVNQAEHVGALQGLHPYRVRHLLDRYGSLISDVLAMAASDPSLLSPITEAPG
YLKVEAAYAAAAEGALHLEDILARRMRISIEYPHRGVDCAREVAEVVAPVLGWTAADIDR
EVANYMARVEAEVLSQAQPDDVSADMLRASAPEARAEILEPVPLD
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaacccaatccaggcaccggacggcgggcaggggtggcccgccgcggcgctagga
cctgcacagcgcgcggtcgcctggaagcgactcggaaccgagcaattcgacgtcgtggtg
atcggcggcggagtagtgggctccggatgcgctttggatgctgccacccgtgggctcaag
gtggcgttggtcgaggcgcgggacttggcctccggcacgtcgagccgctcctcgaagatg
ttccacggcgggctgcgctacctcgagcaactggagttcgggctggtgcgtgaggcgctc
tatgaacgtgaactgtcgctgaccacgctggcaccgcatttggtcaagccgctgccgttt
ttgttcccgctgaccaaacgctggtgggagcgtccctacatcgccgcgggtatctttctt
tacgaccggctgggtggcgcgaaatcggttccggcgcaacggcattttactcgcgccggt
gcgctgcgactgagccccggcttgaagcgcagctcgctgatcggtggtatccgttactac
gacaccgtcgtcgacgacgcccggcacaccatgacggtcgcgcgcaccgcggcgcattac
ggcgcggttgtccgctgctccacccaggtagtggccttgttgcgagagggtgaccgggtg
atcggcgtgggcgtccgcgactccgagaacggcgcggttgccgaggttcgcggccacgtc
gtggtcaacgcgaccggggtctggaccgatgagattcaagcgttgtccaaacagcgcggg
cgcttccaggtgcgcgcatccaagggcgtgcatgtggtggtgccgcgggaccggattgtc
agtgacgtcgcgatgatcctgcgcacggagaagtcggtgatgtttgtcattccgtgggga
agtcactggatcatcggaaccaccgataccgactggaacctcgacctggcgcaccccgcg
gccaccaaggccgacatcgactacatcctgggcactgtcaacgccgtgttggcgaccccg
ttgacgcacgccgacattgacggagtgtacgccgggctgcggccgctgcttgccggggaa
agcgacgacacctccaagctgtcccgggaacacgccgtggctgtgccggcggcgggcctg
gtggccatcgccggtggcaagtacaccacctaccgagtaatggcggccgacgcgatcgac
gctgctgtgcagttcatccccgcccgcgttgcgccgtcgatcaccgagaaggtcagcctg
ctgggcgccgacggttactttgcactggtcaatcaggccgaacacgtcggcgcgctgcag
ggcctgcacccgtaccgggtgcgccatctgctggaccgctatggttcgctgatcagcgac
gttctagcgatggcggcctccgatcccagcctgttgagcccgataacggaggcaccgggc
tatttgaaggtggaagccgcttacgccgccgccgccgagggcgccctgcatctcgaggac
atcctggcccgtcggatgcggatttccatcgaatacccgcaccggggcgtcgactgcgcc
cgggaggtggccgaggtggtcgcgcccgtgctcgggtggaccgccgcagacatcgaccgc
gaggtcgcgaactatatggcgcgcgtggaggccgaggtgctctcccaggcccagcccgac
gacgtttcggcggacatgttgcgggccagcgcacccgaggcgcgtgccgagatcctcgag
ccggtgcctttggattga

DBGET integrated database retrieval system