KEGG   Methylosinus trichosporium: CQW49_11255Help
Entry
CQW49_11255       CDS       T05155                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mtw  Methylosinus trichosporium
Pathway
mtw00473  D-Alanine metabolism
mtw00550  Peptidoglycan biosynthesis
mtw01100  Metabolic pathways
mtw01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mtw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CQW49_11255
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CQW49_11255
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    CQW49_11255
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mtw01011]
    CQW49_11255
Enzymes [BR:mtw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CQW49_11255
Peptidoglycan biosynthesis and degradation proteins [BR:mtw01011]
 Precursor biosynthesis
  Amino acid ligase
   CQW49_11255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 CPSase_L_D2 ATP-grasp DUF5014
Motif
Other DBs
NCBI-ProteinID: ATQ68394
UniProt: A0A2D2D0C4
LinkDB All DBs
Position
2344570..2345505
Genome map
AA seq 311 aa AA seqDB search
MTAPVAVHVAVLMGGLSSERPISLRSGAACAEALEGEGFRVTRVDVGRDVAEVLAALKPD
VAFNALHGRFGEDGCIQGILETLHIPYTHSGVLASSLAMRKDVAKSVMAAAGVPVPKGRV
LSRQEAAKAHALPPPYVLKPVSEGSSFGVFIVKEGRSHPPQELAAADWKHGDLMLAENFV
DGRELTCAVMGDRALGVIEILPVSEEFYGFDAKYAKGGSKHVLPANLKQNIYQEVQQLAL
EAHRALGCRGVSRADFRYDDSPGGTGDLVVLEVNTQPGMTETSLVPEMAAHAGYSFGGLV
RWMVEDASCDR
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgacagctcccgtcgccgttcacgtcgccgttctcatgggcgggctctcctcggagcgg
ccgatctcgctgcgctcgggcgccgcctgcgccgaggcgctggagggcgagggctttcgc
gtcacgcgcgtcgatgtcggccgcgacgtggccgaggtcctcgcagcgctgaagcccgac
gtcgccttcaacgcgctgcacggccgcttcggcgaggacggctgcatccagggcatattg
gagactctgcacatcccctacactcattccggcgtgctggcctcctcgctggcgatgcgc
aaggacgtggccaagagcgtcatggcggcggccggagtgccggttcccaagggccgcgtg
ctgagccggcaggaggccgccaaagcccatgcgctgccgccgccctatgtgctgaagccg
gtgagcgaaggctcctccttcggcgtgttcatcgtcaaggaggggcgctcgcatccgccg
caggagctcgccgccgccgattggaaacacggcgacctcatgctcgccgaaaattttgtg
gacggccgcgagctcacttgcgccgtgatgggcgacagggcgctgggcgtcatcgagatt
ctccccgtgtccgaggagttctacggcttcgacgcgaaatacgccaaaggcggctccaaa
cacgtgcttccggcaaatcttaaacaaaatatttaccaagaggtccaacagttggcgctc
gaggctcatcgggctctcggctgtcgcggcgtcagccgcgcggactttcgctacgacgat
tcccccggcggcacgggcgatctcgtcgttctggaggtcaacacccagccgggaatgacc
gagacctcactcgtaccggaaatggccgctcacgcgggctattcgtttggcgggcttgtg
agatggatggtggaagacgcgtcctgcgatcgctga

DBGET integrated database retrieval system