KEGG   Mycobacterium tuberculosis KZN 605: TBXG_001371Help
Entry
TBXG_001371       CDS       T02141                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase gabT
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
mtz  Mycobacterium tuberculosis KZN 605
Pathway
mtz00250  Alanine, aspartate and glutamate metabolism
mtz00280  Valine, leucine and isoleucine degradation
mtz00410  beta-Alanine metabolism
mtz00640  Propanoate metabolism
mtz00650  Butanoate metabolism
mtz01100  Metabolic pathways
mtz01120  Microbial metabolism in diverse environments
Module
mtz_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mtz00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    TBXG_001371
   00650 Butanoate metabolism
    TBXG_001371
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TBXG_001371
   00280 Valine, leucine and isoleucine degradation
    TBXG_001371
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TBXG_001371
Enzymes [BR:mtz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     TBXG_001371
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     TBXG_001371
Amino acid related enzymes [BR:mtz01007]
 Aminotransferase (transaminase)
  Class III
   TBXG_001371
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AFM48769
LinkDB All DBs
Position
complement(1496218..1497567)
Genome map
AA seq 449 aa AA seqDB search
MASLQQSRRLVTEIPGPASQALTHRRAAAVSSGVGVTLPVFVARAGGGIVEDVDGNRLID
LGSGIAVTTIGNSSPRVVDAVRTQVAEFTHTCFMVTPYEGYVAVAEQLNRITPGSGPKRS
VLFNSGAEAVENAVKIARSYTGKPAVVAFDHAYHGRTNLTMALTAKSMPYKSGFGPFAPE
IYRAPLSYPYRDGLLDKQLATNGELAAARAIGVIDKQVGANNLAALVIEPIQGEGGFIVP
AEGFLPALLDWCRKNHVVFIADEVQTGFARTGAMFACEHEGPDGLEPDLICTAKGIADGL
PLSAVTGRAEIMNAPHVGGLGGTFGGNPVACAAALATIATIESDGLIERARQIERLVTDR
LTTLQAVDDRIGDVRGRGAMIAVELVKSGTTEPDAGLTERLATAAHAAGVIILTCGMFGN
IIRLLPPLTIGDELLSEGLDIVCAILADL
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtggccagcctgcagcagagtcggcgcctggtcaccgaaatccccggtcccgcatcgcag
gcactgactcaccgccgggcggcggcggtgtccagcggtgttggggtcaccctgccggtg
ttcgtagcccgcgccggcggcggcatcgtggaagacgtggacggtaaccggctcatcgac
ctgggttcgggcatcgcagtgacgacgatcggcaactcgtcgccacgcgtggtggatgcg
gtgcgcacgcaggtggccgaatttacccacacctgcttcatggtgacgccatacgagggg
tacgtggccgtcgccgagcaactcaaccggattaccccaggttcgggccccaagcgctcg
gtgttgttcaattccggcgccgaggcagtcgagaacgccgtcaagatcgcacgctcctac
accggcaagcccgcggtggtggcgttcgaccacgcctaccacggtcgcaccaacctaacg
atggcgctgaccgccaagtcgatgccctacaagagcggcttcggtccgttcgcgccggag
atctaccgagcgccattgtcttacccctatcgggacggcctcctcgataagcaactggct
accaatggtgagctagccgcggcccgagccatcggcgtcatcgacaagcaggtaggcgcg
aacaacctggccgccctcgtcatcgaaccgatccagggcgaaggcggtttcatcgttccg
gccgaagggttcctacctgccctcctcgattggtgccgcaagaaccatgtggtgttcatc
gccgacgaggtgcaaaccggctttgcccgtaccggggcgatgttcgcctgcgagcacgag
ggccccgacggtctagagcccgacctgatctgcacggccaaaggcatcgccgatggattg
ccgctgtcggcggtcaccggccgcgccgagatcatgaacgccccgcacgtgggcggcctg
ggcggcacgttcggcggcaacccggtggcctgtgcggccgcgctggccaccatcgcaacc
atcgaaagcgacgggctgatcgagcgggcccgccagatcgaacgcctggtgaccgaccgg
ttgacgacgctgcaggccgtcgacgaccggatcggcgacgtgcgtggtcgcggcgccatg
atcgccgtagagctggtcaaatccggaaccaccgagcccgacgccgggctgaccgagcgg
ctggcgaccgcggcccacgccgccggcgtcatcattttgacctgcggcatgttcggcaac
atcatccggctactgccgccgctgaccatcggcgacgagctgctgagtgaggggctggac
atcgtgtgcgcgatcttggccgacctctga

DBGET integrated database retrieval system