KEGG   Meriones unguiculatus (Mongolian gerbil): 110545262Help
Entry
110545262         CDS       T05884                                 

Definition
(RefSeq) 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial
  KO
K07436  vitamin D3 24-hydroxylase [EC:1.14.15.16]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun00100  Steroid biosynthesis
mun01100  Metabolic pathways
mun04928  Parathyroid hormone synthesis, secretion and action
mun05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    110545262
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    110545262
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    110545262
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:mun00199]
    110545262
Enzymes [BR:mun01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.16  vitamin D3 24-hydroxylase
     110545262
Cytochrome P450 [BR:mun00199]
 Cytochrome P450, animal type
  CYP24 family
   110545262
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 110545262
NCBI-ProteinID: XP_021486928
LinkDB All DBs
Position
Unknown
AA seq 511 aa AA seqDB search
MSCPTDKRRSLVAFLRRLRDLGQPPMSKASAPREPKEVPLCPLVTGAKTRDATSLPGPTN
WPLLGSLLEILWKGGLKKQHDTLAEYHKNYGEIFRMKLGSFDSVHLGSPRLLEALYRTES
AHPQRMEIKPWKAYRDYRNESYGLLILEGKEWQRVRSAFQKKLMKPVEVMKLDNKINEVL
ADFVGRMDKLCDEGGRIKDLYSELNKWSFESICLVLYEKRFGLLQEEVGEEALTFIAAIK
TMMSTFGKMMVTPVELHKTLNTKVWQEHTLAWDTIFKSVKPCIDSRLEKYSQQPSEDFLC
DIYQHNRLSKKELYAAVTELQLAAVETTANSLMWILYNLARNPQVQQRLLLEIQSVLPKN
QTPRAEDVRNIPYLKACLKESMRVTPSVPFTTRTLDKPTVLGDYTLPKGTLLTLNTQVLG
SSEDNFGDSDQFRPERWLQKERKINPFAHLPFGLGKRMCIGRRLAELQLHLALCWIIQKY
NIVATDNEPVEMLHLGILVPSRELPIAFCPR
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagctgccccactgataaaaggcgctccctggtggctttcctgcgccggctgcgcgac
ctcggacagccccccatgtccaaggcgagcgctccccgcgagccaaaagaggtgcccctc
tgcccgctggtgacaggtgctaagactcgggacgccacctccctgcctggacccaccaac
tggccactgctaggcagtttactggagattctttggaaagggggcctgaagaaacagcat
gatactctggccgagtaccacaagaactacggtgagattttccggatgaagctgggctcc
ttcgactcggtccacctgggctcgccgagactgctggaagctctgtaccgcaccgagagc
gcacatccccagcgaatggagatcaagccctggaaagcctatcgcgactaccgcaacgag
agctacgggttgctgatcctggaaggaaaagagtggcagagggtccgcagcgccttccaa
aagaaactaatgaagccggtggaggtcatgaagctggacaacaaaatcaatgaggtcttg
gctgattttgtgggaagaatggataagctgtgtgatgaaggaggccgcatcaaggacttg
tacagcgaactgaataaatggtcctttgaaagtatctgccttgtactatatgagaaaaga
tttgggcttcttcaggaggaggtaggggaggaggcactgaccttcatcgctgccatcaaa
acaatgatgagcacatttggaaagatgatggtgacccccgtggagttgcacaagaccctc
aacaccaaagtgtggcaggagcacacactggcctgggacaccattttcaaatcagtcaag
ccttgcatcgacagccgcttggagaaatactcccagcagcccagtgaagatttcctttgt
gatatttatcagcacaatcgcctttccaagaaagaactgtatgctgctgtcacagagctc
cagctggctgcggtggagacgacggccaacagcttgatgtggattctctacaacctagcc
cggaatccccaagtacagcagagacttcttctggaaatccagagcgtgttgcccaagaac
cagacgccacgggcagaagacgtgaggaatataccctacttaaaggcctgtctgaaagaa
tccatgagggtcaccccaagtgtgccgtttacaactcggaccctggacaagccaacggtt
ctgggtgactacactttacccaaaggaacactgttgaccctaaatacccaagtgctgggt
tccagtgaagacaacttcggagactccgaccagtttagacctgaacgctggcttcagaag
gagagaaagatcaatcccttcgcccatctcccatttggcctcgggaagaggatgtgcatt
gggcgccgactggctgagttacagctccacttggctctttgctggatcatccaaaaatat
aatattgtggctacagacaatgaacctgtggagatgctgcatctcggcatcttggtaccc
agccgggagctgcccattgcattctgtccgcggtag

DBGET integrated database retrieval system