KEGG   Meriones unguiculatus (Mongolian gerbil): 110545874
Entry
110545874         CDS       T05884                                 

Gene name
Il2
Definition
(RefSeq) interleukin-2
  KO
K05429  interleukin 2
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04060  Cytokine-cytokine receptor interaction
mun04061  Viral protein interaction with cytokine and cytokine receptor
mun04151  PI3K-Akt signaling pathway
mun04625  C-type lectin receptor signaling pathway
mun04630  Jak-STAT signaling pathway
mun04658  Th1 and Th2 cell differentiation
mun04659  Th17 cell differentiation
mun04660  T cell receptor signaling pathway
mun04672  Intestinal immune network for IgA production
mun04940  Type I diabetes mellitus
mun05135  Yersinia infection
mun05142  Chagas disease (American trypanosomiasis)
mun05162  Measles
mun05166  Human T-cell leukemia virus 1 infection
mun05200  Pathways in cancer
mun05320  Autoimmune thyroid disease
mun05321  Inflammatory bowel disease (IBD)
mun05330  Allograft rejection
mun05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    110545874 (Il2)
   04151 PI3K-Akt signaling pathway
    110545874 (Il2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110545874 (Il2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    110545874 (Il2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110545874 (Il2)
   04660 T cell receptor signaling pathway
    110545874 (Il2)
   04658 Th1 and Th2 cell differentiation
    110545874 (Il2)
   04659 Th17 cell differentiation
    110545874 (Il2)
   04672 Intestinal immune network for IgA production
    110545874 (Il2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110545874 (Il2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110545874 (Il2)
   05321 Inflammatory bowel disease (IBD)
    110545874 (Il2)
   05330 Allograft rejection
    110545874 (Il2)
   05332 Graft-versus-host disease
    110545874 (Il2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110545874 (Il2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110545874 (Il2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110545874 (Il2)
   05162 Measles
    110545874 (Il2)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    110545874 (Il2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mun04052]
    110545874 (Il2)
   00536 Glycosaminoglycan binding proteins [BR:mun00536]
    110545874 (Il2)
Cytokines and growth factors [BR:mun04052]
 Cytokines
  Interleukins
   110545874 (Il2)
Glycosaminoglycan binding proteins [BR:mun00536]
 Heparan sulfate / Haparin
  Cytokines
   110545874 (Il2)
SSDB
Motif
Pfam: IL2 Desmo_N
Other DBs
NCBI-GeneID: 110545874
NCBI-ProteinID: XP_021487963
LinkDB
Position
Unknown
AA seq 155 aa
MYSRQLASCVALALVLLANSAPTSSPAKEAQQYLEQLLLDLQQLLRGINNYKNPKLPMLL
TFKFYMPRKATELKHLQCLEEELGPLHDVLNLVQSKNLYLEDAGNFISNIRVTVMKLKGS
ENTLNCEFDDETVTVVEFLSRWITFCQSAISTMTQ
NT seq 468 nt   +upstreamnt  +downstreamnt
atgtacagcaggcagctcgcatcctgtgttgcactggcgctagtactccttgccaacagt
gcacccacttcaagccctgccaaggaggcacagcagtacctggagcagttgctgctggac
ttacagcagctcctgagagggatcaacaattacaagaatccgaaactccccatgctgctc
acgtttaaattttacatgccgaggaaggccacagaactgaagcatcttcagtgcttggaa
gaagaacttggacctctgcatgatgtgctaaatttggttcaaagcaaaaacctttacttg
gaagatgctgggaatttcatcagcaatatcagagtaactgttatgaaactaaagggctca
gaaaacacactcaactgcgaatttgatgatgaaacagtgactgtggtggaattcctgagc
agatggataaccttctgtcaaagtgccatctcaacaatgactcaataa

DBGET integrated database retrieval system