KEGG   Meriones unguiculatus (Mongolian gerbil): 110546395
Entry
110546395         CDS       T05884                                 

Gene name
Oas1
Definition
(RefSeq) 2'-5'-oligoadenylate synthase 1
  KO
K14216  2'-5'-oligoadenylate synthetase [EC:2.7.7.84]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04621  NOD-like receptor signaling pathway
mun05160  Hepatitis C
mun05162  Measles
mun05164  Influenza A
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mun00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110546395 (Oas1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110546395 (Oas1)
   05171 Coronavirus disease - COVID-19
    110546395 (Oas1)
   05164 Influenza A
    110546395 (Oas1)
   05162 Measles
    110546395 (Oas1)
   05168 Herpes simplex virus 1 infection
    110546395 (Oas1)
   05169 Epstein-Barr virus infection
    110546395 (Oas1)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.84  2'-5' oligoadenylate synthase
     110546395 (Oas1)
SSDB
Motif
Pfam: OAS1_C NTP_transf_2 SMODS
Other DBs
NCBI-GeneID: 110546395
NCBI-ProteinID: XP_021488875
LinkDB
Position
Unknown
AA seq 382 aa
MGQGLSRIPASDLDKFIEDHLCPDPGFRANVRAAIDIVCAFLKERCFQGAAHPMRVSKVV
KGGSSGKGTALRGRSDADLVVFLNNLTSFEDQLNRRGEVIKEIRKQLYELQRERHFTVRF
EVQSSWWPNSRALSFKLSSPQLQQEVEFDVLPAYDVLGHVSIYRRPDPQIYARLIRECTA
LGKEGEFSTCFTELQRNFLKQRPTKLKSLIRLVKHWYQLCKERLGKPLPPQYALELLTVY
AWERGSLSTDFNTARGFRTVLGLVIKYRDLRIYWTVNYDFQHQEVANYLHRQLRSERPVI
LDPADPTGNIAASNLEGWRRLAGEATAWLQYPCFKHRDGSPVCPWDVPTEVDVPEQEDHF
LRNLCLIFFFSFLFLFGRATSV
NT seq 1149 nt   +upstreamnt  +downstreamnt
atggggcagggactcagcagaatcccggcctcagacctggacaagttcatagaggatcac
ctctgtcctgaccccggcttccgtgctaacgtcagagcggccatcgacatcgtgtgtgct
ttcctgaaggagagatgcttccaaggagctgcccaccctatgagggtctccaaggtggtg
aagggtggctcctcgggcaaaggcactgcgctcaggggcagatcggatgcggacctggtg
gtgttcttgaacaatctcaccagctttgaggaccagttgaaccgacggggagaggtcatc
aaggaaattaggaaacagctgtacgagttgcagcgtgagagacatttcacagtgcggttt
gaggtccagagttcatggtggcccaactcccgggctctgagcttcaagctgagctccccc
cagctccagcaggaggtggagtttgatgtgctgccagcctatgatgtcctgggtcacgtc
agcatctaccggaggcctgacccccaaatctacgccagactcatcagggagtgcactgcc
ctggggaaggagggcgagttctccacctgcttcacggagctgcagcggaacttcctgaag
cagcgtccaaccaagctgaagagtctcatccgcctggtcaagcactggtaccaactgtgt
aaagagaggctggggaagccgctgcccccacagtatgccctggagctgctcacagtctat
gcctgggaacgtggtagtctgtccactgacttcaacacagcacgaggcttccggacagtc
ttaggcctggtcatcaagtacagggatcttcgaatctactggacagtgaattatgatttc
caacaccaggaggttgccaactacctgcacagacagctcagaagcgagaggcctgtgatc
ctggacccagctgacccaacaggaaacattgctgcttcaaacctggaaggctggaggcgg
ctggcaggcgaggccactgcctggctgcagtacccatgctttaagcacagagatgggtcc
ccagtgtgcccctgggatgtgccgacggaggtggatgttccagagcaggaggaccacttt
cttcgtaatctctgtctaattttcttcttttcgtttctttttctttttggaagggctact
tctgtgtag

KEGG   Meriones unguiculatus (Mongolian gerbil): 110546404
Entry
110546404         CDS       T05884                                 

Gene name
Oas3
Definition
(RefSeq) 2'-5'-oligoadenylate synthase 3
  KO
K14216  2'-5'-oligoadenylate synthetase [EC:2.7.7.84]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04621  NOD-like receptor signaling pathway
mun05160  Hepatitis C
mun05162  Measles
mun05164  Influenza A
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mun00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110546404 (Oas3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110546404 (Oas3)
   05171 Coronavirus disease - COVID-19
    110546404 (Oas3)
   05164 Influenza A
    110546404 (Oas3)
   05162 Measles
    110546404 (Oas3)
   05168 Herpes simplex virus 1 infection
    110546404 (Oas3)
   05169 Epstein-Barr virus infection
    110546404 (Oas3)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.84  2'-5' oligoadenylate synthase
     110546404 (Oas3)
SSDB
Motif
Pfam: OAS1_C NTP_transf_2 SMODS Polbeta
Other DBs
NCBI-GeneID: 110546404
NCBI-ProteinID: XP_021488890
LinkDB
Position
Unknown
AA seq 1131 aa
MNLYRTPAGALDKLVAHSLHPLPEFILAVRGALGALDVALRKQGAQGSQRPRVIRIAKGG
AYARGTALRGGGDAELVIFLNCFRSYGDQKTCHTETLGAMRVLLESWGRHPGPGLTFQFS
EPKAPGVLQFRLASADQENWMDVSLVPAFDVLGQPRPGVKPTPQVYSSLLSSGCQAGEHA
ACFTELRRSFVNVRPAKLKNLILLVKHWYRQVQTQEAVRATLPPSYALELLTIFAWEQAC
RKDSFSLAQGLRTVLALIQQNKHLCIFWTENYGFEDPVVGEFLRRQLERPRPVILDPADP
TWDVGNGTAWRWDVLAKEAASCINQQCFLEASGVPVQPWKVSGLLHADILGLGHPIQQGP
NEALEDKKGHGAVLPKTRSLQPSDSAPGVPEATTEAVLPTACKASKSLKAAHPGTVGKTA
PSVSSHNRITRSTPSSNAPPHRSIATSVSTAGSEMVPDLSQIPSKELDSFIQDKLRPSAQ
SQQQVRQAIDAILRCLQEKCVHKASRVSKGGSFGRGTDLRGVCDVELVIFYKALRDFKGQ
RSRQAEILCDMQTQLQAWCRDPVPGLSLRFAEQNRPNALQLQLVSTDLSSWVDVSVLPTF
DAVGPLNTSTKPQPQVYSSLLSSGCQAGEHEACFAELRPVKLKSLMLLVKHWYRQVATRD
RGGEAAGATLPPAYALELLTIFAWEQGCGEEKFSMAEGLRTVLRLVQKHQSLCVYWTVNY
SVQDPALRAHLLGLLRKARPLVLDPVDPTWNVAQGSWELLAQEAAALESQVCLQSGDGTL
LPPWDVMPTLLHQTPAEDLDKFISEFLQPNSHFLTQVKKAVDTICSFLKENCFRNSTTKV
LKVVKGGSSAKGTALQGRSDADLVVFLSCFRQFSEQGSHRAELISEIQAQLEACRRKQRF
DVKFEISQRKNPRALSFSLTSQTQLDQSVDFDVLPAFDALGQLRSHARPDPQVYRDLIHS
YSNAGEFSACFTELQRDFIVSRPTKLKSLIRLVKHWYQQCNKKLKGKGSLPAQHGLELLT
VYAWEQGSRNSQFNMAEGFRTVLELVGQYRQLCIYWTVNYSAEDETIGDFLRMQLQKPRP
IILDPADPTGNLGHNARWDLLAQEARAFMSALCCMDKDGTSIRPWLVKATV
NT seq 3396 nt   +upstreamnt  +downstreamnt
atgaacctgtaccgcacaccagccggagctctggacaagctggtggcccacagcctgcac
ccactccctgagttcatattggctgtgcgaggtgctctgggggccctggacgtcgccctg
cggaagcagggagcccaagggtcacagagaccaagggtgataaggatcgccaagggagga
gcctatgcccggggcacagctctcaggggtggcggtgacgctgaacttgtcatcttcctc
aactgcttcaggagctatggggaccagaagacctgtcacacggagaccctgggtgccatg
agggtgttgctggagtcgtgggggcggcacccggggcctggcctgacttttcagttttct
gagccaaaggcacctggggtcttgcagtttcgtctggcttcagcagaccaggaaaactgg
atggatgttagcctggtgcctgcctttgatgtcctgggacagccccgccctggagtcaag
cccacaccccaggtgtactcctccctcctcagcagcggctgccaggctggggagcacgca
gcctgcttcacagaactccgaaggagcttcgtgaacgttcgcccagccaagcttaagaac
ttaatcctgctggtcaaacactggtacagacaggtacagacgcaggaggccgtgagggcc
acgctgccccccagctacgccctggagctgcttaccatctttgcctgggagcaggcctgt
aggaaggattctttcagcctggcccaagggctccggaccgtcctggccttgatccagcag
aacaagcacctctgcattttctggacggaaaactacggcttcgaagaccccgtggtcggg
gagttcttgcgaaggcagcttgagaggccccggcccgtgatcctggatccggctgacccg
acttgggacgtgggcaacgggacagcctggcgctgggatgtgctggccaaggaggccgcg
tcctgcattaatcagcagtgcttcctggaggcatcaggagtcccagtgcagccttggaag
gtgtctggccttctccatgctgatatcttgggtttgggccaccccatccaacaagggcct
aatgaggccctggaagacaagaaaggccacggtgctgtgctgccaaagacaaggagcctg
cagccttccgattcagctccaggggtcccagaagcaaccaccgaggctgttctgcccacg
gcctgtaaagccagcaagagcctcaaagcagcacatccagggaccgtcgggaaaacagca
ccgagtgtctcaagtcacaataggatcacccggagcaccccatcctcaaacgcgcctccc
caccgctcaatcgcaaccagcgtctccaccgctgggtcagagatggtcccggatctgtcg
caaatccccagcaaggagctggactccttcatccaggacaagctgaggccgagtgcccag
tcccagcagcaggtgaggcaggccatcgacgccatcctgcgatgcctccaggagaagtgt
gtacacaaagcttccagggtcagcaagggcggctctttcggccgaggcacagacctcagg
ggtgtctgtgacgtggagcttgtcatcttttacaaagccctcagggacttcaagggccag
aggtcccgccaagccgagatcctgtgtgacatgcaaacccagctacaggcctggtgtcgg
gacccggtgcctgggctgagcctccggtttgctgaacagaacaggcccaatgctctgcag
ctccagctggtgtccacagacctcagcagctgggtagacgtcagtgtgctgcccactttc
gatgctgtggggccactgaacaccagcaccaaaccccagccccaggtgtactcgtccctc
ctcagcagcggctgccaggcgggggaacatgaggcctgctttgcagagctccgcccagtc
aagcttaagagcctgatgctactggtcaagcactggtaccgccaggttgccactcgagac
agaggaggagaggcagcgggcgccactctgcccccagcctatgccctggagcttctgaca
atctttgcctgggagcaaggctgtggggaggagaagttcagcatggctgaaggccttcgg
accgtcctgaggctggtccagaagcaccagtcactctgtgtctactggacagtcaactac
agcgtgcaggacccggccctcagagcacaccttctcggcctgctccggaaagccaggcct
cttgtcctggaccctgtggatcccacctggaatgtggcccagggcagctgggagctgtta
gctcaggaggcagcggccctggagtcacaggtctgccttcagagtggggatgggactctg
ctgccgccctgggatgtgatgccaaccctccttcaccagactccagctgaggacctggac
aagttcattagtgaattcctccagcccaactcccacttcctgactcaggtgaagaaagcg
gtcgacaccatctgctccttcctgaaggagaactgtttccggaactctaccaccaaggtg
ctcaaggtggtcaagggcgggtcttctgccaaaggcactgctctacaggggcgctcagac
gctgacctggtagtgttcctcagctgcttccgccagttctcggagcaaggcagccaccgg
gccgagctcatctcagagatccaggctcagctggaggcgtgccggcggaagcagcgcttc
gacgtcaagtttgagatctcccagaggaagaacccccgagcgctcagcttctcgctgaca
tcccagacgcagctggaccagagcgtggactttgacgtgctgccagccttcgatgctctt
ggccagctgaggtcccacgctaggcctgatccccaggtctacagagacctcatccacagc
tacagtaacgcgggcgagttctccgcctgcttcacggagctgcagagggatttcattgtc
tcccgccccaccaaactcaagagcctcatccggctggtgaaacactggtaccaacagtgt
aacaagaagctcaaggggaagggctccttgccagcccagcatgggctggagctcctgacg
gtgtacgcctgggagcagggcagccggaacagccaattcaacatggcagagggcttccga
accgttctggaactggttggccagtaccgtcagctctgcatctactggaccgtcaactac
agtgcagaggacgagaccatcggtgacttcctgaggatgcagcttcagaagcccaggccc
atcatcctggatccagctgacccgacaggcaacctgggccacaatgcccgttgggacctg
cttgcccaggaggctagagcattcatgtctgccctgtgctgcatggacaaggacggcacc
tccatcaggccatggctggtaaaggccaccgtgtga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110546405
Entry
110546405         CDS       T05884                                 

Definition
(RefSeq) 2'-5'-oligoadenylate synthase 2-like
  KO
K14216  2'-5'-oligoadenylate synthetase [EC:2.7.7.84]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04621  NOD-like receptor signaling pathway
mun05160  Hepatitis C
mun05162  Measles
mun05164  Influenza A
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mun00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110546405
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110546405
   05171 Coronavirus disease - COVID-19
    110546405
   05164 Influenza A
    110546405
   05162 Measles
    110546405
   05168 Herpes simplex virus 1 infection
    110546405
   05169 Epstein-Barr virus infection
    110546405
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.84  2'-5' oligoadenylate synthase
     110546405
SSDB
Motif
Pfam: OAS1_C SMODS NTP_transf_2
Other DBs
NCBI-GeneID: 110546405
NCBI-ProteinID: XP_021488891
LinkDB
Position
Unknown
AA seq 718 aa
MGNWLASESSGGSPGWSPGHSPGWPAHKLDEYIQANLKPNEGCLRQIDQAADAICAFLRS
NGIPVEAVAKGGSYGRQTVLRGFSDGTLVLFMGHFQQFQDQKKNQYKLLDLIGQQLKNHE
KYKNSVNRGATLEVAVSIQGQKMLLQLLPAFNPLCFGENPSSRVYRDLKKAMDQAGASPG
EFAACFTTLQQRFFERCPRKLKDLILLVKHWYQECQQKWMASPPPSLLYALELLTVYAWE
QGCQDEDFDIAEGVRTVLHLVRQSTKLCVYWTVNYNFEDETVRNTLLHQLRSQRPIILDP
ADPTNNVGRDYGFWQLLTAEAQAWLSSPSLNVSSGPCWNVLPTPLFITPSHLLDKFIGDF
LQPNKVFLEQIKKAVDIICSFLKEHCFRYSSTNVLKVIKGGSSAKGTALKNGSDADIVVF
LSSLNSYHSQKNERPLFVQEIRKQLEACQQAYEWEVEFEISKWEAPRVLSFTLKSKHLNE
SVDFDILPAYDALGQLRSGFTSRPKAYNELIELYASPSFIGGEFSTCFTELQRNFIEPRP
TKLKSLLRLVKHWYKQCERKMKAKPSLPPKYALELLTVYAWEQGSGMNDFETAEGFRTVL
DLVIKYQQLCIFWTVNYDFQDEPMRTFLLTQIQKKRPVILDPADPTGDVGGGDRWCWHLL
AKEAKEWLSSLCFQLPGRDLEGQRGLVQPWSVPVVQTPGSCGAQIYPTVGGGYFERRF
NT seq 2157 nt   +upstreamnt  +downstreamnt
atgggaaattggctggctagtgagtcctctggtgggtcacctggctggtcacctggccac
tcacctggatggccagcgcacaagctagacgagtatatccaggcaaacctcaaacccaac
gaaggatgtctgaggcagatagaccaggctgcggacgccatctgtgccttcctgcgaagc
aatggcatccctgtggaggcagtggcgaagggtggctcctatggccggcaaacagtcctg
cgaggcttctccgacggtacccttgttctcttcatgggtcacttccagcagttccaggat
cagaagaaaaaccaatataaactcctcgatttgattggacaacagctgaaaaaccatgag
aagtacaagaattcagtaaaccgtggggccacccttgaagtagcagtgtccatacaaggg
cagaagatgctcttgcagctgcttccagccttcaatcctctttgcttcggtgagaacccc
agctccagggtctatcgggacctcaaaaaagccatggatcaagccggagcctcgccgggg
gagttcgcggcctgcttcaccacactgcagcagcgattcttcgaacgatgccccaggaag
ctgaaggacttgatcctgttggtcaagcactggtaccaagagtgccagcagaagtggatg
gcttccccgcccccgtcactgttgtacgcactggagctcctcactgtgtacgcctgggag
cagggctgccaggatgaagacttcgacatcgcagaaggtgtcaggaccgtgctgcacctc
gtcaggcagtcgacaaagctgtgtgtctactggaccgtcaactacaactttgaggatgag
acggtcaggaacacccttttacaccagctcaggtcccaaaggccgatcatcttggatcca
gctgacccaaccaataatgtgggcagagactatgggttctggcagctgctgacagcggag
gctcaggcctggctgtcctctcccagcctgaatgtgtcgagtgggccatgttggaatgtt
ctgcccacgccactcttcatcacaccaagccacttactagacaagttcatcggagacttc
ctccagcctaacaaggtcttcctagagcagatcaaaaaagccgtggacatcatctgttca
ttcctgaaagaacactgcttccggtactcaagcaccaatgtcctgaaggttatcaaggga
ggatccagtgccaaaggcacagctctgaagaatggctcagacgctgacatcgttgtgttc
ctcagttcgctgaacagttaccactcccaaaaaaacgagcgtcccctgttcgtccaggag
atccggaagcagttagaagcctgccagcaggcctatgagtgggaggtggagttcgagatc
tccaagtgggaggcccccagggtgctgagcttcaccttgaaatccaagcatctcaacgag
agcgtcgactttgacatccttcctgcctatgacgcgctggggcaactgcgttccggcttc
acctccaggcccaaagcctacaacgagcttattgaactgtatgcatcacccagcttcatc
ggaggcgagttttcaacctgttttacggagctacagcgaaacttcattgaacctcggccc
accaaactcaagagtcttctccgcctggtcaagcactggtacaaacagtgtgaaaggaaa
atgaaggcaaaaccgtctttgcccccaaagtatgccctggagctgctcactgtgtatgcc
tgggagcagggcagtggcatgaatgacttcgaaactgctgaaggcttccggactgtcctg
gacctggtcataaagtaccagcagctctgcatcttctggacggtcaactacgacttccaa
gacgagccgatgaggacattcctcctgacccagatccagaaaaagaggcctgtgatcctg
gatcccgcagatcccacaggtgacgtgggaggaggtgaccgctggtgttggcatcttcta
gccaaagaagcgaaggagtggctgtcctccctctgtttccaactgccaggcagagacctt
gagggacaaaggggcctcgtacagccgtggagcgtgccagtggtgcagaccccaggaagc
tgtggagctcagatctaccccactgtaggtggagggtacttcgaaagacgcttctag

KEGG   Meriones unguiculatus (Mongolian gerbil): 110546406
Entry
110546406         CDS       T05884                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: 2'-5'-oligoadenylate synthase 1A-like
  KO
K14216  2'-5'-oligoadenylate synthetase [EC:2.7.7.84]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04621  NOD-like receptor signaling pathway
mun05160  Hepatitis C
mun05162  Measles
mun05164  Influenza A
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mun00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    110546406
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    110546406
   05171 Coronavirus disease - COVID-19
    110546406
   05164 Influenza A
    110546406
   05162 Measles
    110546406
   05168 Herpes simplex virus 1 infection
    110546406
   05169 Epstein-Barr virus infection
    110546406
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.84  2'-5' oligoadenylate synthase
     110546406
SSDB
Motif
Pfam: OAS1_C NTP_transf_2 SMODS Polbeta
Other DBs
NCBI-GeneID: 110546406
NCBI-ProteinID: XP_021488892
LinkDB
Position
Unknown
AA seq 379 aa
MDLSRTPAWELDKFIEDHLLPNTRFRAEVRAAIDFICAFLKERCFQGAAHRVRVSKVVKG
GSSGKGTALRGRSDADLVVFLNNLTSFEDQLNRRGEVIKEIKKQLYELQRERHFTVQFEV
QSSWXPNSRALSFKLSSPQLQQEVEFDVLPAYDVLGQVRNNCKPDPQIYARLIRECTALG
KEGEFSTCFTELQRNFLKQRPTKLKSLICLVKHWYQLCKEKLGKPLPPQYALELLTFYAW
ERGCGSSEFNTARGFRTVLGLVTKYRQLXIYWTVNYDFQHQEVANYLYRQLRRTRPVILD
PADPTGNVATSNLEGWRRLAGEATAWLQYPCVKNRDGSPVCPWDVPTEVDVPEQKDCFFX
LSLIFSFLFLFLFGRATSV
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggatctcagcagaaccccagcctgggagctggacaagttcatagaggatcatctcctt
cctaacaccaggttccgtgccgaggtcagagcagccattgacttcatatgtgccttcctg
aaggagagatgcttccaaggcgctgcccaccgtgtgagggtctccaaggtggtgaagggc
ggctcctcgggcaaaggcactgcgctcaggggcagatcggatgcggacctggtggtgttc
ctgaacaatctcaccagctttgaggaccagttgaaccgacggggagaggtcatcaaggaa
attaagaaacagctgtacgagttgcagcgtgagagacatttcacagtgcagtttgaggtc
cagagttcatggtagcccaactcccgggctctgagcttcaagctgagctccccccagctc
cagcaggaggtggagtttgatgtgctgccggcctatgatgtcctgggtcaagtcagaaac
aactgcaaacctgacccccaaatctacgccagactcatcagggagtgcactgccctgggg
aaggagggcgagttctccacctgcttcacggagctgcagaggaacttcctgaagcagcgt
ccaaccaagctgaagagtctcatctgcctggtcaagcactggtaccaactgtgtaaggag
aagctggggaagccgctgcccccacagtacgccctggagctgctcacattctatgcctgg
gaacgtgggtgtggatccagtgagttcaacacagcccggggcttccggacagtcttaggc
ctggtcaccaagtacaggcagctttgaatctactggacagtgaattatgatttccaacac
caggaggtcgctaactacctgtacagacagctcagaagaaccaggcctgtgatcctggac
ccagctgacccaacaggaaacgttgctacttcaaacctggaaggctggaggcggctggca
ggcgaggccactgcctggctgcagtacccatgcgttaagaacagagatggttccccagtg
tgcccctgggatgtgccgacggaggtggatgttccagagcagaaggactgcttttttncc
ttatctctaattttctcgtttttgtttctttttctttttggaagggctacttctgtgtag

DBGET integrated database retrieval system