KEGG   Meriones unguiculatus (Mongolian gerbil): 110552020
Entry
110552020         CDS       T05884                                 

Gene name
Stat1
Definition
(RefSeq) signal transducer and activator of transcription 1-alpha/beta isoform X1
  KO
K11220  signal transducer and activator of transcription 1
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04062  Chemokine signaling pathway
mun04217  Necroptosis
mun04380  Osteoclast differentiation
mun04620  Toll-like receptor signaling pathway
mun04621  NOD-like receptor signaling pathway
mun04625  C-type lectin receptor signaling pathway
mun04630  JAK-STAT signaling pathway
mun04658  Th1 and Th2 cell differentiation
mun04659  Th17 cell differentiation
mun04917  Prolactin signaling pathway
mun04919  Thyroid hormone signaling pathway
mun04933  AGE-RAGE signaling pathway in diabetic complications
mun04935  Growth hormone synthesis, secretion and action
mun05140  Leishmaniasis
mun05145  Toxoplasmosis
mun05152  Tuberculosis
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05162  Measles
mun05164  Influenza A
mun05165  Human papillomavirus infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05168  Herpes simplex virus 1 infection
mun05169  Epstein-Barr virus infection
mun05171  Coronavirus disease - COVID-19
mun05200  Pathways in cancer
mun05212  Pancreatic cancer
mun05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mun05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110552020 (Stat1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    110552020 (Stat1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110552020 (Stat1)
   04621 NOD-like receptor signaling pathway
    110552020 (Stat1)
   04625 C-type lectin receptor signaling pathway
    110552020 (Stat1)
   04658 Th1 and Th2 cell differentiation
    110552020 (Stat1)
   04659 Th17 cell differentiation
    110552020 (Stat1)
   04062 Chemokine signaling pathway
    110552020 (Stat1)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    110552020 (Stat1)
   04935 Growth hormone synthesis, secretion and action
    110552020 (Stat1)
   04919 Thyroid hormone signaling pathway
    110552020 (Stat1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110552020 (Stat1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110552020 (Stat1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110552020 (Stat1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    110552020 (Stat1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    110552020 (Stat1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    110552020 (Stat1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    110552020 (Stat1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    110552020 (Stat1)
   05160 Hepatitis C
    110552020 (Stat1)
   05171 Coronavirus disease - COVID-19
    110552020 (Stat1)
   05164 Influenza A
    110552020 (Stat1)
   05162 Measles
    110552020 (Stat1)
   05168 Herpes simplex virus 1 infection
    110552020 (Stat1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110552020 (Stat1)
   05169 Epstein-Barr virus infection
    110552020 (Stat1)
   05165 Human papillomavirus infection
    110552020 (Stat1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110552020 (Stat1)
   05140 Leishmaniasis
    110552020 (Stat1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mun03000]
    110552020 (Stat1)
Transcription factors [BR:mun03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    110552020 (Stat1)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind STAT1_TAZ2bind SH2 BLI1 TRPM_tetra
Other DBs
NCBI-GeneID: 110552020
NCBI-ProteinID: XP_021498708
LinkDB
Position
Unknown
AA seq 870 aa
MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAACDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPVQMSMIICNCLKEERKILENAQ
RFNQAQEGNIQNTVMLDKQKELDCKVRNVKDQVMCIEQEIKTLEDLQDEYDFKCKTSQNR
ESEANGVAKNDQKQEQLLLHKMFLMLDNKRKEIIHKIRELLNAIELTQNTLINDELVEWK
RRQQSACIGGPPNACLDQLQSWFTIVAESLQQVRQQLKKLEELEQKFTYEQDPVTKNKQV
LWDRCFVLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVSFDKDVNEKNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGNRTN
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVTE
PRNLSFFLNPPCARWSQLSEVLSWQFSSVTKRGLNADQLSMLGEKLLGPSASPDGLIPWT
RFCKENINDKNFSFWPWIDTILELIKKHLLCLWNDGCIMGFISKERERALLKDQQPGTFL
LRFSESSREGAITFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDDPKRTGYIKTELISVSEVHPSRLQTT
DNLLPMSPEEFDEMSRIVGSEFDSMKIAWPSPLALLMGSLTGHFLCTRQALLAPTEAKAA
LGEEPVTGIWHAEFQLSSPLFSVTWKNEAASSSVCAESTALICWKVMLWGISHPQANSRK
WFCSLWVAPVALRSSGFTGHIGLHRDCVTK
NT seq 2613 nt   +upstreamnt  +downstreamnt
atgtctcagtggtacgagcttcagcagctggactccaagttcctggagcaagtccaccag
ctgtatgatgacagctttcccatggagatcagacagtacctggcccagtggctagagaag
caagactgggagcatgcagcctgtgacgtctcatttgccaccatccgcttccatgacctc
ctctctcagctggatgatcagtacagccgcttttctctggagaataacttcttgttgcag
cacaacataaggaaaagcaagcgtaatcttcaggataacttccaagaagatcctgtgcag
atgtccatgataatctgtaactgtctgaaggaagagaggaagattttggaaaatgcacaa
agatttaatcaggcacaggaggggaatattcagaacactgtgatgctagataagcagaag
gagctggactgtaaagtcagaaatgtgaaggaccaagtcatgtgcatagagcaggaaatc
aagaccctagaagatttacaagatgaatatgactttaaatgcaaaacctcacagaacaga
gaaagtgaagccaatggtgtggcgaagaatgaccaaaagcaggaacagctgctgctccat
aagatgtttttaatgcttgacaataagagaaaggagataattcacaaaataagagagttg
ttgaatgccatcgagctcactcagaataccctgatcaatgatgagttagtggagtggaag
cgaagacagcagagtgcctgtatcgggggaccgcccaacgcctgcctcgatcagctgcaa
agctggttcaccattgttgcagagagtctgcagcaggttcgtcagcagcttaaaaagctg
gaggagctggagcagaaattcacctatgaacaggatcctgtaacaaaaaacaagcaggtg
ttatgggatcgctgcttcgtcctcttccagcagctcattcagagctccttcgtggtagaa
cgacagccatgcatgccaactcatcctcagagaccactggtcttgaagactggggtacag
ttcactgtgaagttgagactgttggtgaaattgcaagagctgaattataatctgaaagtg
aaagtttcatttgataaagatgtaaacgagaaaaacacagtgaaaggatttcggaagttc
aacattttgggtacgcacacaaaagtgatgaacatggaagagtctaccaacggaagtttg
gcagctgagttccgacacctgcaactgaaggaacagaagaacgctggcaacagaactaat
gaggggcctctcattgtcactgaggaacttcactctcttagctttgaaacccagttgtgc
cagccaggcctggtaattgaccttgagacaacctctctgcctgtcgtggtgatctccaat
gttagccagctccccagtggctgggcttctatcctgtggtacaacatgctggtgacagag
cccaggaatctctccttcttcctgaacccgccatgtgcgaggtggtcccagctctcagag
gtgctgagctggcagttttcatcagtcaccaagagaggtctcaacgcagaccagctgagc
atgctgggagagaagcttctgggtcccagtgctagccctgacggtcttattccatggacg
aggttttgtaaggaaaatattaatgataaaaacttttccttctggccttggattgacacc
atcctagaactgattaagaagcacctgctctgcctctggaatgatgggtgcatcatgggc
tttatcagcaaggagcgagaacgtgctctgctcaaggaccagcagccggggaccttcctg
cttcggttcagcgagagctcccgggaaggagccatcacgttcacgtgggtggagcggtct
caaaacggaggtgaacctgacttccacgccgttgaaccctacacgaagaaagaactttca
gctgttactttcccagatattattcgcaattacaaagtcatggctgctgagaacatacca
gagaatcccctgaagtatctgtatcccaatattgacaaagaccacgcctttggaaaatat
tactccaggccaaaggaagcaccagagcccatggagctcgacgaccctaagcgaactgga
tacatcaagactgagttgatatctgtgtctgaagtccatccttccagacttcagaccaca
gacaacctgcttcccatgtctccagaggagttcgatgagatgtcccggatagtgggctcc
gaatttgacagtatgaaaatcgcctggccatcaccactggcactgttgatggggtcactt
acagggcacttcctgtgcaccaggcaggctctgttggcacctactgaggcgaaggcagca
ttgggtgaggagcctgtgactggaatttggcatgcagagttccagctgtcatcaccattg
ttctctgtgacctggaaaaacgaagctgccagttcctccgtttgtgcagagagcactgct
ctaatatgctggaaggtgatgctgtggggcatttcacaccctcaggcaaattccaggaaa
tggttttgtagtctttgggtggcccctgtagctcttcgatccagtggttttacaggccac
attgggctacacagagactgtgtcacaaaataa

DBGET integrated database retrieval system