KEGG   Meriones unguiculatus (Mongolian gerbil): 110552285
Entry
110552285         CDS       T05884                                 

Gene name
Mapk8
Definition
(RefSeq) mitogen-activated protein kinase 8 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01522  Endocrine resistance
mun04010  MAPK signaling pathway
mun04012  ErbB signaling pathway
mun04014  Ras signaling pathway
mun04024  cAMP signaling pathway
mun04068  FoxO signaling pathway
mun04071  Sphingolipid signaling pathway
mun04137  Mitophagy - animal
mun04140  Autophagy - animal
mun04141  Protein processing in endoplasmic reticulum
mun04210  Apoptosis
mun04215  Apoptosis - multiple species
mun04217  Necroptosis
mun04310  Wnt signaling pathway
mun04380  Osteoclast differentiation
mun04510  Focal adhesion
mun04530  Tight junction
mun04620  Toll-like receptor signaling pathway
mun04621  NOD-like receptor signaling pathway
mun04622  RIG-I-like receptor signaling pathway
mun04625  C-type lectin receptor signaling pathway
mun04657  IL-17 signaling pathway
mun04658  Th1 and Th2 cell differentiation
mun04659  Th17 cell differentiation
mun04660  T cell receptor signaling pathway
mun04664  Fc epsilon RI signaling pathway
mun04668  TNF signaling pathway
mun04722  Neurotrophin signaling pathway
mun04723  Retrograde endocannabinoid signaling
mun04728  Dopaminergic synapse
mun04750  Inflammatory mediator regulation of TRP channels
mun04910  Insulin signaling pathway
mun04912  GnRH signaling pathway
mun04914  Progesterone-mediated oocyte maturation
mun04917  Prolactin signaling pathway
mun04920  Adipocytokine signaling pathway
mun04926  Relaxin signaling pathway
mun04930  Type II diabetes mellitus
mun04931  Insulin resistance
mun04932  Non-alcoholic fatty liver disease
mun04933  AGE-RAGE signaling pathway in diabetic complications
mun04935  Growth hormone synthesis, secretion and action
mun05010  Alzheimer disease
mun05012  Parkinson disease
mun05016  Huntington disease
mun05017  Spinocerebellar ataxia
mun05020  Prion disease
mun05022  Pathways of neurodegeneration - multiple diseases
mun05132  Salmonella infection
mun05133  Pertussis
mun05135  Yersinia infection
mun05142  Chagas disease
mun05145  Toxoplasmosis
mun05152  Tuberculosis
mun05161  Hepatitis B
mun05162  Measles
mun05166  Human T-cell leukemia virus 1 infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05171  Coronavirus disease - COVID-19
mun05200  Pathways in cancer
mun05210  Colorectal cancer
mun05212  Pancreatic cancer
mun05231  Choline metabolism in cancer
mun05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110552285 (Mapk8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110552285 (Mapk8)
   04012 ErbB signaling pathway
    110552285 (Mapk8)
   04014 Ras signaling pathway
    110552285 (Mapk8)
   04310 Wnt signaling pathway
    110552285 (Mapk8)
   04668 TNF signaling pathway
    110552285 (Mapk8)
   04068 FoxO signaling pathway
    110552285 (Mapk8)
   04071 Sphingolipid signaling pathway
    110552285 (Mapk8)
   04024 cAMP signaling pathway
    110552285 (Mapk8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110552285 (Mapk8)
   04137 Mitophagy - animal
    110552285 (Mapk8)
  09143 Cell growth and death
   04210 Apoptosis
    110552285 (Mapk8)
   04215 Apoptosis - multiple species
    110552285 (Mapk8)
   04217 Necroptosis
    110552285 (Mapk8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110552285 (Mapk8)
   04530 Tight junction
    110552285 (Mapk8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110552285 (Mapk8)
   04621 NOD-like receptor signaling pathway
    110552285 (Mapk8)
   04622 RIG-I-like receptor signaling pathway
    110552285 (Mapk8)
   04625 C-type lectin receptor signaling pathway
    110552285 (Mapk8)
   04660 T cell receptor signaling pathway
    110552285 (Mapk8)
   04658 Th1 and Th2 cell differentiation
    110552285 (Mapk8)
   04659 Th17 cell differentiation
    110552285 (Mapk8)
   04657 IL-17 signaling pathway
    110552285 (Mapk8)
   04664 Fc epsilon RI signaling pathway
    110552285 (Mapk8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110552285 (Mapk8)
   04920 Adipocytokine signaling pathway
    110552285 (Mapk8)
   04912 GnRH signaling pathway
    110552285 (Mapk8)
   04914 Progesterone-mediated oocyte maturation
    110552285 (Mapk8)
   04917 Prolactin signaling pathway
    110552285 (Mapk8)
   04926 Relaxin signaling pathway
    110552285 (Mapk8)
   04935 Growth hormone synthesis, secretion and action
    110552285 (Mapk8)
  09156 Nervous system
   04728 Dopaminergic synapse
    110552285 (Mapk8)
   04723 Retrograde endocannabinoid signaling
    110552285 (Mapk8)
   04722 Neurotrophin signaling pathway
    110552285 (Mapk8)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110552285 (Mapk8)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110552285 (Mapk8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110552285 (Mapk8)
   05231 Choline metabolism in cancer
    110552285 (Mapk8)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110552285 (Mapk8)
   05212 Pancreatic cancer
    110552285 (Mapk8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110552285 (Mapk8)
   05012 Parkinson disease
    110552285 (Mapk8)
   05016 Huntington disease
    110552285 (Mapk8)
   05017 Spinocerebellar ataxia
    110552285 (Mapk8)
   05020 Prion disease
    110552285 (Mapk8)
   05022 Pathways of neurodegeneration - multiple diseases
    110552285 (Mapk8)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110552285 (Mapk8)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110552285 (Mapk8)
   04932 Non-alcoholic fatty liver disease
    110552285 (Mapk8)
   04931 Insulin resistance
    110552285 (Mapk8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110552285 (Mapk8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110552285 (Mapk8)
   05135 Yersinia infection
    110552285 (Mapk8)
   05133 Pertussis
    110552285 (Mapk8)
   05152 Tuberculosis
    110552285 (Mapk8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110552285 (Mapk8)
   05170 Human immunodeficiency virus 1 infection
    110552285 (Mapk8)
   05161 Hepatitis B
    110552285 (Mapk8)
   05171 Coronavirus disease - COVID-19
    110552285 (Mapk8)
   05162 Measles
    110552285 (Mapk8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110552285 (Mapk8)
   05169 Epstein-Barr virus infection
    110552285 (Mapk8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110552285 (Mapk8)
   05142 Chagas disease
    110552285 (Mapk8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110552285 (Mapk8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mun01001]
    110552285 (Mapk8)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     110552285 (Mapk8)
Protein kinases [BR:mun01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   110552285 (Mapk8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 110552285
NCBI-ProteinID: XP_021499127
LinkDB
Position
Unknown
AA seq 427 aa
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTVEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSPSVNDMSSMSTDPTLASDTDSSLEASA
GPLGCCR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagcagaagcaaacgcgacaacaatttttacagtgtagagattggagactctaccttc
acagtcttaaaacgataccagaatttaaagccaataggctcaggggctcaaggaatagtg
tgtgcagcttatgatgccattcttgaaagaaatgttgcaatcaagaagctcagccggcca
tttcagaatcaaactcatgctaagcgagcctaccgagaactagttcttatgaaatgtgtt
aatcacaaaaatataattgggcttttgaatgttttcacgccacagaaatccctagaagaa
ttccaagatgtttacatagtcatggagctcatggatgcaaacctttgccaagtgattcag
atggagttagatcatgaaagaatgtcctaccttctctatcaaatgctgtgtggaatcaag
caccttcactctgctggaattattcatcgggacttaaagcctagtaatatagtagtcaaa
tcagactgcactttgaagatccttgatttcggactggcaaggactgcagggacgagtttt
atgatgacgccttatgtggtgactcgctactacagagcaccagaggtcatccttggcatg
ggctacaaggagaacgtggatttatggtctgtggggtgcattatgggagaaatggtttgc
cacaaaatcctctttccaggaagggactatattgatcaatggaataaagttattgaacag
cttggaacaccttgtcctgagtttatgaagaagctacaaccaacagtaaggacttatgtg
gaaaacagacctaaatatgctggatatagttttgagaaactattccctgacgtgcttttc
ccagctgactcagagcataacaaacttaaagccagtcaggcaagagatttgttatccaaa
atgctagtaatagatgcatccaaaaggatctctgtagatgaagctctccagcacccatac
atcaacgtctggtatgatccttcagaagcagaagccccgccaccaaagatccctgacaag
cagttagatgagagggagcacacagtagaggaatggaaagaactgatatacaaggaggta
atggacttggaagagcgaactaagaatggagtcataagaggacagccatctcctttaggt
gcagcagtgatcaatggctctcagcatccatcgtcttcaccgtctgtcaatgacatgtct
tcaatgtccacagatccgactttggcctcggatacagacagcagtctagaagcatcggcc
ggacctctgggctgttgtagatga

KEGG   Meriones unguiculatus (Mongolian gerbil): 110557386
Entry
110557386         CDS       T05884                                 

Gene name
Mapk9
Definition
(RefSeq) mitogen-activated protein kinase 9 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01522  Endocrine resistance
mun04010  MAPK signaling pathway
mun04012  ErbB signaling pathway
mun04014  Ras signaling pathway
mun04024  cAMP signaling pathway
mun04068  FoxO signaling pathway
mun04071  Sphingolipid signaling pathway
mun04137  Mitophagy - animal
mun04140  Autophagy - animal
mun04141  Protein processing in endoplasmic reticulum
mun04210  Apoptosis
mun04215  Apoptosis - multiple species
mun04217  Necroptosis
mun04310  Wnt signaling pathway
mun04380  Osteoclast differentiation
mun04510  Focal adhesion
mun04530  Tight junction
mun04620  Toll-like receptor signaling pathway
mun04621  NOD-like receptor signaling pathway
mun04622  RIG-I-like receptor signaling pathway
mun04625  C-type lectin receptor signaling pathway
mun04657  IL-17 signaling pathway
mun04658  Th1 and Th2 cell differentiation
mun04659  Th17 cell differentiation
mun04660  T cell receptor signaling pathway
mun04664  Fc epsilon RI signaling pathway
mun04668  TNF signaling pathway
mun04722  Neurotrophin signaling pathway
mun04723  Retrograde endocannabinoid signaling
mun04728  Dopaminergic synapse
mun04750  Inflammatory mediator regulation of TRP channels
mun04910  Insulin signaling pathway
mun04912  GnRH signaling pathway
mun04914  Progesterone-mediated oocyte maturation
mun04917  Prolactin signaling pathway
mun04920  Adipocytokine signaling pathway
mun04926  Relaxin signaling pathway
mun04930  Type II diabetes mellitus
mun04931  Insulin resistance
mun04932  Non-alcoholic fatty liver disease
mun04933  AGE-RAGE signaling pathway in diabetic complications
mun04935  Growth hormone synthesis, secretion and action
mun05010  Alzheimer disease
mun05012  Parkinson disease
mun05016  Huntington disease
mun05017  Spinocerebellar ataxia
mun05020  Prion disease
mun05022  Pathways of neurodegeneration - multiple diseases
mun05132  Salmonella infection
mun05133  Pertussis
mun05135  Yersinia infection
mun05142  Chagas disease
mun05145  Toxoplasmosis
mun05152  Tuberculosis
mun05161  Hepatitis B
mun05162  Measles
mun05166  Human T-cell leukemia virus 1 infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05169  Epstein-Barr virus infection
mun05170  Human immunodeficiency virus 1 infection
mun05171  Coronavirus disease - COVID-19
mun05200  Pathways in cancer
mun05210  Colorectal cancer
mun05212  Pancreatic cancer
mun05231  Choline metabolism in cancer
mun05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110557386 (Mapk9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110557386 (Mapk9)
   04012 ErbB signaling pathway
    110557386 (Mapk9)
   04014 Ras signaling pathway
    110557386 (Mapk9)
   04310 Wnt signaling pathway
    110557386 (Mapk9)
   04668 TNF signaling pathway
    110557386 (Mapk9)
   04068 FoxO signaling pathway
    110557386 (Mapk9)
   04071 Sphingolipid signaling pathway
    110557386 (Mapk9)
   04024 cAMP signaling pathway
    110557386 (Mapk9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110557386 (Mapk9)
   04137 Mitophagy - animal
    110557386 (Mapk9)
  09143 Cell growth and death
   04210 Apoptosis
    110557386 (Mapk9)
   04215 Apoptosis - multiple species
    110557386 (Mapk9)
   04217 Necroptosis
    110557386 (Mapk9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    110557386 (Mapk9)
   04530 Tight junction
    110557386 (Mapk9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110557386 (Mapk9)
   04621 NOD-like receptor signaling pathway
    110557386 (Mapk9)
   04622 RIG-I-like receptor signaling pathway
    110557386 (Mapk9)
   04625 C-type lectin receptor signaling pathway
    110557386 (Mapk9)
   04660 T cell receptor signaling pathway
    110557386 (Mapk9)
   04658 Th1 and Th2 cell differentiation
    110557386 (Mapk9)
   04659 Th17 cell differentiation
    110557386 (Mapk9)
   04657 IL-17 signaling pathway
    110557386 (Mapk9)
   04664 Fc epsilon RI signaling pathway
    110557386 (Mapk9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    110557386 (Mapk9)
   04920 Adipocytokine signaling pathway
    110557386 (Mapk9)
   04912 GnRH signaling pathway
    110557386 (Mapk9)
   04914 Progesterone-mediated oocyte maturation
    110557386 (Mapk9)
   04917 Prolactin signaling pathway
    110557386 (Mapk9)
   04926 Relaxin signaling pathway
    110557386 (Mapk9)
   04935 Growth hormone synthesis, secretion and action
    110557386 (Mapk9)
  09156 Nervous system
   04728 Dopaminergic synapse
    110557386 (Mapk9)
   04723 Retrograde endocannabinoid signaling
    110557386 (Mapk9)
   04722 Neurotrophin signaling pathway
    110557386 (Mapk9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    110557386 (Mapk9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110557386 (Mapk9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110557386 (Mapk9)
   05231 Choline metabolism in cancer
    110557386 (Mapk9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110557386 (Mapk9)
   05212 Pancreatic cancer
    110557386 (Mapk9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110557386 (Mapk9)
   05012 Parkinson disease
    110557386 (Mapk9)
   05016 Huntington disease
    110557386 (Mapk9)
   05017 Spinocerebellar ataxia
    110557386 (Mapk9)
   05020 Prion disease
    110557386 (Mapk9)
   05022 Pathways of neurodegeneration - multiple diseases
    110557386 (Mapk9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110557386 (Mapk9)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110557386 (Mapk9)
   04932 Non-alcoholic fatty liver disease
    110557386 (Mapk9)
   04931 Insulin resistance
    110557386 (Mapk9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110557386 (Mapk9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110557386 (Mapk9)
   05135 Yersinia infection
    110557386 (Mapk9)
   05133 Pertussis
    110557386 (Mapk9)
   05152 Tuberculosis
    110557386 (Mapk9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110557386 (Mapk9)
   05170 Human immunodeficiency virus 1 infection
    110557386 (Mapk9)
   05161 Hepatitis B
    110557386 (Mapk9)
   05171 Coronavirus disease - COVID-19
    110557386 (Mapk9)
   05162 Measles
    110557386 (Mapk9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110557386 (Mapk9)
   05169 Epstein-Barr virus infection
    110557386 (Mapk9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110557386 (Mapk9)
   05142 Chagas disease
    110557386 (Mapk9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    110557386 (Mapk9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mun01001]
    110557386 (Mapk9)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     110557386 (Mapk9)
Protein kinases [BR:mun01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   110557386 (Mapk9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo RIO1 APH Kinase-like FTA2
Other DBs
NCBI-GeneID: 110557386
NCBI-ProteinID: XP_021507405
LinkDB
Position
Unknown
AA seq 423 aa
MSDSKGDGQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVKDQPSDAAVSSKATPSQSSSINDISSMSTEHTLASDTDSSLDASTGPLE
GCR
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgagtgacagtaaaggcgatggtcagttttacagtgtgcaagtggcggactcaactttc
actgttctaaaacgttaccagcaactgaaaccaatcgggtctggagcccaaggaattgtc
tgtgctgcttttgatacagttcttgggataaatgttgctgtcaagaagttaagccgtcct
tttcaaaaccaaacgcacgcaaagagagcctatcgtgaacttgtcctcttaaagtgtgtc
aaccataaaaatataattagcttgttaaatgtgttcacaccacaaaaaactctagaagaa
tttcaagatgtgtacttggtcatggaattaatggatgctaacttatgtcaggttattcat
atggagctggaccatgaaagaatgtcataccttctctaccagatgctctgtggcattaag
catctgcattcagctggcataattcacagagatttgaagcctagcaacattgtagtaaaa
tcagactgtaccctcaagattcttgactttggcctggcacggaccgcctgtaccaacttt
atgatgaccccctatgtggtgactcgctactaccgggccccagaagtcatcctgggcatg
ggctacaaagagaatgttgatatctggtcagtgggttgcatcatgggagagctggtgaaa
ggttgtgtgatattccaaggcactgaccatattgatcaatggaataaagttattgaacag
ctaggaacaccgtccgcagagttcatgaagaaacttcagccaactgtgaggaattatgtg
gaaaacagaccaaagtaccctggaatcaaatttgaagagctctttccagattggatattt
ccatcagaatctgagcgagacaaaattaaaacaagtcaagctagagatctgttatcgaaa
atgttagtgattgatccagacaagcggatctctgtggacgaagccttgcgtcacccgtat
atcactgtttggtatgaccccgctgaagcagaagcgccaccacctcaaatttatgatgcc
cagttggaagaaagagagcatgcaattgaagagtggaaagaactaatttacaaagaagtg
atggactgggaagaaagaagcaagaatggagtaaaggaccagccttcagatgcagcagta
agtagcaaggccactccttctcagtcgtcatccatcaacgacatctcatccatgtccact
gagcacaccctggcctcagacacagacagcagtctcgatgcctcaacaggaccccttgaa
ggctgccgatga

DBGET integrated database retrieval system