KEGG   Meriones unguiculatus (Mongolian gerbil): 110555271
Entry
110555271         CDS       T05884                                 

Gene name
Socs1
Definition
(RefSeq) suppressor of cytokine signaling 1
  KO
K04694  suppressor of cytokine signaling 1
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04120  Ubiquitin mediated proteolysis
mun04380  Osteoclast differentiation
mun04630  JAK-STAT signaling pathway
mun04910  Insulin signaling pathway
mun04917  Prolactin signaling pathway
mun04930  Type II diabetes mellitus
mun04935  Growth hormone synthesis, secretion and action
mun05145  Toxoplasmosis
mun05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mun00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    110555271 (Socs1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    110555271 (Socs1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    110555271 (Socs1)
   04917 Prolactin signaling pathway
    110555271 (Socs1)
   04935 Growth hormone synthesis, secretion and action
    110555271 (Socs1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    110555271 (Socs1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    110555271 (Socs1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110555271 (Socs1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110555271 (Socs1)
Ubiquitin system [BR:mun04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     110555271 (Socs1)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 110555271
NCBI-ProteinID: XP_021504080
LinkDB
Position
Unknown
AA seq 212 aa
MVARNQVAADNAISSAAEPRRRPEPSSSSSSSSPAAPARPRPCPAIPAPAPGDTHFRTFR
SHSDYRRITRTSALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKM
ASGPTSIRVHFQAGRFHLDGSRETFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCR
QRIVAAVGRENLARIPLNPVLRDYLSSFPFQI
NT seq 639 nt   +upstreamnt  +downstreamnt
atggtagcacgcaaccaggtggcagccgacaatgcgatctcctcggcagcagagccccga
cggcggccagagccctcctcgtcctcgtcttcctcctcgccggcggcccccgcgcgtccg
cggccctgccctgcgatcccggccccggccccgggcgacactcacttccgcacgttccgc
tcccactccgattaccggcgcatcacgcggaccagcgcgctcctggacgcctgcggcttc
tattggggacccctgagcgtgcacggggcgcacgagcgactgcgtgccgagcccgtgggc
accttcctggtgcgcgacagtcgccaacggaactgcttctttgcgcttagcgtgaagatg
gcttcgggacccacgagcatccgcgtgcacttccaggctggccgcttccacctggacggc
agccgcgagaccttcgactgcctcttcgagctgctggagcactacgtggcggcgcctcgc
cgcatgttgggggccccgctgcgccagcgccgcgtgcggccgctacaggagctgtgtcgc
cagcgcatcgtggccgccgtgggtcgcgagaacctggcgcgcatccctctcaacccggta
ctccgcgactacctgagttccttccccttccaaatctga

DBGET integrated database retrieval system